Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 1239415..1239983 Replicon chromosome
Accession NZ_CP127274
Organism Mycobacterium tuberculosis strain 17221

Toxin (Protein)


Gene name vapC Uniprot ID G0TH08
Locus tag QRF10_RS05960 Protein ID WP_003405865.1
Coordinates 1239609..1239983 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TH07
Locus tag QRF10_RS05955 Protein ID WP_003405863.1
Coordinates 1239415..1239612 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF10_RS05935 (QRF10_05935) 1235456..1236094 - 639 WP_003898730.1 lipid droplet-associated protein -
QRF10_RS05940 (QRF10_05940) 1236184..1237191 + 1008 WP_003405853.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
QRF10_RS05945 (QRF10_05945) 1237208..1238191 - 984 WP_003898731.1 hypothetical protein -
QRF10_RS05950 (QRF10_05950) 1238254..1239327 + 1074 WP_057171789.1 redox-regulated ATPase YchF -
QRF10_RS05955 (QRF10_05955) 1239415..1239612 + 198 WP_003405863.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QRF10_RS05960 (QRF10_05960) 1239609..1239983 + 375 WP_003405865.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF10_RS05965 (QRF10_05965) 1240186..1240884 + 699 WP_003898733.1 hypothetical protein -
QRF10_RS05970 (QRF10_05970) 1241002..1241187 + 186 WP_003901093.1 hypothetical protein -
QRF10_RS05975 (QRF10_05975) 1241114..1241389 - 276 WP_003405867.1 hypothetical protein -
QRF10_RS05980 (QRF10_05980) 1241632..1241955 + 324 WP_003405871.1 putative quinol monooxygenase -
QRF10_RS05985 (QRF10_05985) 1241970..1242668 - 699 WP_031646953.1 hypothetical protein -
QRF10_RS05990 (QRF10_05990) 1242702..1242911 + 210 WP_003911400.1 hypothetical protein -
QRF10_RS05995 (QRF10_05995) 1242863..1243633 - 771 Protein_1181 adenylate/guanylate cyclase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-111)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13444.56 Da        Isoelectric Point: 5.1881

>T283829 WP_003405865.1 NZ_CP127274:1239609-1239983 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS

Download         Length: 375 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 6973.03 Da        Isoelectric Point: 11.7327

>AT283829 WP_003405863.1 NZ_CP127274:1239415-1239612 [Mycobacterium tuberculosis]
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TH08

Antitoxin

Source ID Structure
AlphaFold DB G0TH07

References