Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 1239415..1239983 | Replicon | chromosome |
| Accession | NZ_CP127274 | ||
| Organism | Mycobacterium tuberculosis strain 17221 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TH08 |
| Locus tag | QRF10_RS05960 | Protein ID | WP_003405865.1 |
| Coordinates | 1239609..1239983 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TH07 |
| Locus tag | QRF10_RS05955 | Protein ID | WP_003405863.1 |
| Coordinates | 1239415..1239612 (+) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF10_RS05935 (QRF10_05935) | 1235456..1236094 | - | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
| QRF10_RS05940 (QRF10_05940) | 1236184..1237191 | + | 1008 | WP_003405853.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
| QRF10_RS05945 (QRF10_05945) | 1237208..1238191 | - | 984 | WP_003898731.1 | hypothetical protein | - |
| QRF10_RS05950 (QRF10_05950) | 1238254..1239327 | + | 1074 | WP_057171789.1 | redox-regulated ATPase YchF | - |
| QRF10_RS05955 (QRF10_05955) | 1239415..1239612 | + | 198 | WP_003405863.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QRF10_RS05960 (QRF10_05960) | 1239609..1239983 | + | 375 | WP_003405865.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QRF10_RS05965 (QRF10_05965) | 1240186..1240884 | + | 699 | WP_003898733.1 | hypothetical protein | - |
| QRF10_RS05970 (QRF10_05970) | 1241002..1241187 | + | 186 | WP_003901093.1 | hypothetical protein | - |
| QRF10_RS05975 (QRF10_05975) | 1241114..1241389 | - | 276 | WP_003405867.1 | hypothetical protein | - |
| QRF10_RS05980 (QRF10_05980) | 1241632..1241955 | + | 324 | WP_003405871.1 | putative quinol monooxygenase | - |
| QRF10_RS05985 (QRF10_05985) | 1241970..1242668 | - | 699 | WP_031646953.1 | hypothetical protein | - |
| QRF10_RS05990 (QRF10_05990) | 1242702..1242911 | + | 210 | WP_003911400.1 | hypothetical protein | - |
| QRF10_RS05995 (QRF10_05995) | 1242863..1243633 | - | 771 | Protein_1181 | adenylate/guanylate cyclase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13444.56 Da Isoelectric Point: 5.1881
>T283829 WP_003405865.1 NZ_CP127274:1239609-1239983 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|