Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 840946..841655 | Replicon | chromosome |
Accession | NZ_CP127274 | ||
Organism | Mycobacterium tuberculosis strain 17221 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF74 |
Locus tag | QRF10_RS03985 | Protein ID | WP_003403837.1 |
Coordinates | 841227..841655 (+) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TEX4 |
Locus tag | QRF10_RS03980 | Protein ID | WP_003403834.1 |
Coordinates | 840946..841203 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF10_RS03975 (QRF10_03975) | 838450..840855 | + | 2406 | WP_012054160.1 | PE family protein | - |
QRF10_RS03980 (QRF10_03980) | 840946..841203 | + | 258 | WP_003403834.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
QRF10_RS03985 (QRF10_03985) | 841227..841655 | + | 429 | WP_003403837.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF10_RS03990 (QRF10_03990) | 841736..841873 | - | 138 | WP_003403839.1 | hypothetical protein | - |
QRF10_RS03995 (QRF10_03995) | 842032..842277 | + | 246 | WP_003403841.1 | hypothetical protein | - |
QRF10_RS04000 (QRF10_04000) | 842346..843230 | - | 885 | WP_003403844.1 | 3-hydroxyisobutyrate dehydrogenase | - |
QRF10_RS04005 (QRF10_04005) | 843241..844413 | - | 1173 | WP_003403845.1 | acyl-CoA dehydrogenase family protein | - |
QRF10_RS04010 (QRF10_04010) | 844420..845952 | - | 1533 | WP_003403847.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15831.27 Da Isoelectric Point: 7.5536
>T283824 WP_003403837.1 NZ_CP127274:841227-841655 [Mycobacterium tuberculosis]
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CDR3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TEX4 |