Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 754684..755224 | Replicon | chromosome |
| Accession | NZ_CP127274 | ||
| Organism | Mycobacterium tuberculosis strain 17221 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P9WII0 |
| Locus tag | QRF10_RS03495 | Protein ID | WP_003403376.1 |
| Coordinates | 754684..754992 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TQE0 |
| Locus tag | QRF10_RS03500 | Protein ID | WP_003403381.1 |
| Coordinates | 754979..755224 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF10_RS03470 (QRF10_03470) | 749999..751504 | + | 1506 | WP_003403360.1 | carotenoid cleavage oxygenase | - |
| QRF10_RS03475 (QRF10_03475) | 751585..752595 | + | 1011 | WP_003911248.1 | ABC transporter ATP-binding protein | - |
| QRF10_RS03480 (QRF10_03480) | 752983..753366 | - | 384 | WP_003912919.1 | ribonuclease VapC6 | - |
| QRF10_RS03485 (QRF10_03485) | 753461..753616 | - | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| QRF10_RS03490 (QRF10_03490) | 753692..754408 | - | 717 | WP_003403371.1 | CPBP family intramembrane metalloprotease | - |
| QRF10_RS03495 (QRF10_03495) | 754684..754992 | - | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QRF10_RS03500 (QRF10_03500) | 754979..755224 | - | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| QRF10_RS03505 (QRF10_03505) | 755334..755771 | - | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | - |
| QRF10_RS03510 (QRF10_03510) | 755768..756022 | - | 255 | WP_003911263.1 | antitoxin VapB7 | - |
| QRF10_RS03515 (QRF10_03515) | 756136..758499 | + | 2364 | WP_003898547.1 | arylsulfatase AtsD | - |
| QRF10_RS03520 (QRF10_03520) | 758562..758888 | + | 327 | WP_003403401.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QRF10_RS03525 (QRF10_03525) | 758800..759138 | + | 339 | WP_003403405.1 | PIN domain-containing protein | - |
| QRF10_RS03530 (QRF10_03530) | 759135..759308 | + | 174 | WP_003898549.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11320.10 Da Isoelectric Point: 11.6554
>T283821 WP_003403376.1 NZ_CP127274:c754992-754684 [Mycobacterium tuberculosis]
MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGLVSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRR
ITRLSPARLHEACQTLRASTGC
MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGLVSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRR
ITRLSPARLHEACQTLRASTGC
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSE5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQE0 |