Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 752983..753616 | Replicon | chromosome |
| Accession | NZ_CP127274 | ||
| Organism | Mycobacterium tuberculosis strain 17221 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QRF10_RS03480 | Protein ID | WP_003912919.1 |
| Coordinates | 752983..753366 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ56 |
| Locus tag | QRF10_RS03485 | Protein ID | WP_003403368.1 |
| Coordinates | 753461..753616 (-) | Length | 52 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF10_RS03455 (QRF10_03455) | 748275..748811 | + | 537 | WP_003403341.1 | 50S ribosomal protein L10 | - |
| QRF10_RS03460 (QRF10_03460) | 748848..749240 | + | 393 | WP_003403353.1 | 50S ribosomal protein L7/L12 | - |
| QRF10_RS03465 (QRF10_03465) | 749233..749928 | - | 696 | WP_003403355.1 | TetR/AcrR family transcriptional regulator | - |
| QRF10_RS03470 (QRF10_03470) | 749999..751504 | + | 1506 | WP_003403360.1 | carotenoid cleavage oxygenase | - |
| QRF10_RS03475 (QRF10_03475) | 751585..752595 | + | 1011 | WP_003911248.1 | ABC transporter ATP-binding protein | - |
| QRF10_RS03480 (QRF10_03480) | 752983..753366 | - | 384 | WP_003912919.1 | ribonuclease VapC6 | Toxin |
| QRF10_RS03485 (QRF10_03485) | 753461..753616 | - | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QRF10_RS03490 (QRF10_03490) | 753692..754408 | - | 717 | WP_003403371.1 | CPBP family intramembrane metalloprotease | - |
| QRF10_RS03495 (QRF10_03495) | 754684..754992 | - | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| QRF10_RS03500 (QRF10_03500) | 754979..755224 | - | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | - |
| QRF10_RS03505 (QRF10_03505) | 755334..755771 | - | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | - |
| QRF10_RS03510 (QRF10_03510) | 755768..756022 | - | 255 | WP_003911263.1 | antitoxin VapB7 | - |
| QRF10_RS03515 (QRF10_03515) | 756136..758499 | + | 2364 | WP_003898547.1 | arylsulfatase AtsD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13989.76 Da Isoelectric Point: 6.0803
>T283820 WP_003912919.1 NZ_CP127274:c753366-752983 [Mycobacterium tuberculosis]
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTATARGLVVLHDDADYELAERHLPDIRVRRVVSADD
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTATARGLVVLHDDADYELAERHLPDIRVRRVVSADD
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|