Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
Location | 694838..695484 | Replicon | chromosome |
Accession | NZ_CP127274 | ||
Organism | Mycobacterium tuberculosis strain 17221 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O07783 |
Locus tag | QRF10_RS03140 | Protein ID | WP_003403122.1 |
Coordinates | 694838..695230 (-) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ86 |
Locus tag | QRF10_RS03145 | Protein ID | WP_003403125.1 |
Coordinates | 695227..695484 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF10_RS03125 (QRF10_03125) | 690500..692026 | + | 1527 | WP_003403112.1 | virulence factor Mce family protein | - |
QRF10_RS03130 (QRF10_03130) | 692089..693231 | + | 1143 | WP_003911253.1 | virulence factor Mce family protein | - |
QRF10_RS03135 (QRF10_03135) | 693236..694786 | + | 1551 | WP_003403119.1 | MlaD family protein | - |
QRF10_RS03140 (QRF10_03140) | 694838..695230 | - | 393 | WP_003403122.1 | type II toxin-antitoxin system toxin ribonuclease C4 | Toxin |
QRF10_RS03145 (QRF10_03145) | 695227..695484 | - | 258 | WP_003403125.1 | type II toxin-antitoxin system antitoxin VapB4 | Antitoxin |
QRF10_RS03150 (QRF10_03150) | 695667..696902 | - | 1236 | WP_003403128.1 | ATP-binding protein | - |
QRF10_RS03155 (QRF10_03155) | 697153..697566 | - | 414 | WP_003403137.1 | type II toxin-antitoxin system VapC family toxin | - |
QRF10_RS03160 (QRF10_03160) | 697563..697799 | - | 237 | WP_003403139.1 | type II toxin-antitoxin system antitoxin VapB27 | - |
QRF10_RS03165 (QRF10_03165) | 697903..698409 | - | 507 | WP_003900973.1 | two component system sensor kinase HK1 | - |
QRF10_RS03170 (QRF10_03170) | 698523..699053 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
QRF10_RS03175 (QRF10_03175) | 699037..699732 | - | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
QRF10_RS03180 (QRF10_03180) | 699855..700166 | + | 312 | WP_003403164.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14080.08 Da Isoelectric Point: 4.6558
>T283814 WP_003403122.1 NZ_CP127274:c695230-694838 [Mycobacterium tuberculosis]
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4F8V4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ86 |