Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-CcdA |
Location | 640227..640903 | Replicon | chromosome |
Accession | NZ_CP127274 | ||
Organism | Mycobacterium tuberculosis strain 17221 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TPQ9 |
Locus tag | QRF10_RS02905 | Protein ID | WP_003898500.1 |
Coordinates | 640227..640640 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TPR0 |
Locus tag | QRF10_RS02910 | Protein ID | WP_003402915.1 |
Coordinates | 640637..640903 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF10_RS02875 (QRF10_02875) | 635572..635874 | - | 303 | WP_003402896.1 | DUF3349 domain-containing protein | - |
QRF10_RS02880 (QRF10_02880) | 635934..636212 | - | 279 | WP_003402901.1 | hypothetical protein | - |
QRF10_RS02885 (QRF10_02885) | 636209..637462 | - | 1254 | WP_003402904.1 | inorganic phosphate transporter | - |
QRF10_RS02890 (QRF10_02890) | 637582..637968 | - | 387 | WP_003402907.1 | VOC family protein | - |
QRF10_RS02895 (QRF10_02895) | 638031..638915 | - | 885 | WP_003402909.1 | SDR family oxidoreductase | - |
QRF10_RS02900 (QRF10_02900) | 639011..639913 | - | 903 | WP_003915439.1 | 1,4-dihydroxy-2-naphthoyl-CoA synthase | - |
QRF10_RS02905 (QRF10_02905) | 640227..640640 | - | 414 | WP_003898500.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF10_RS02910 (QRF10_02910) | 640637..640903 | - | 267 | WP_003402915.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
QRF10_RS02915 (QRF10_02915) | 641095..642810 | - | 1716 | WP_003402917.1 | fatty-acid--CoA ligase FadD8 | - |
QRF10_RS02920 (QRF10_02920) | 642888..644492 | + | 1605 | WP_003402920.1 | amidohydrolase | - |
QRF10_RS02925 (QRF10_02925) | 644489..645469 | + | 981 | WP_003402923.1 | o-succinylbenzoate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14667.78 Da Isoelectric Point: 7.3603
>T283812 WP_003898500.1 NZ_CP127274:c640640-640227 [Mycobacterium tuberculosis]
VRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQRAGALTVAYVDAALEELRQV
PVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLLTTDERLARAWPSAHAIG
VRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQRAGALTVAYVDAALEELRQV
PVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLLTTDERLARAWPSAHAIG
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|