Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 363825..364468 | Replicon | chromosome |
Accession | NZ_CP127274 | ||
Organism | Mycobacterium tuberculosis strain 17221 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFB8 |
Locus tag | QRF10_RS01595 | Protein ID | WP_003401566.1 |
Coordinates | 364043..364468 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | O07227 |
Locus tag | QRF10_RS01590 | Protein ID | WP_003401563.1 |
Coordinates | 363825..364046 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF10_RS01565 (QRF10_01565) | 358944..359747 | - | 804 | WP_003401540.1 | Stf0 family sulphotransferase | - |
QRF10_RS01570 (QRF10_01570) | 359757..361154 | - | 1398 | WP_003914582.1 | sulfatase | - |
QRF10_RS01575 (QRF10_01575) | 361333..363108 | + | 1776 | WP_010886074.1 | PE family protein | - |
QRF10_RS01580 (QRF10_01580) | 363251..363478 | + | 228 | WP_003401555.1 | ribbon-helix-helix protein, CopG family | - |
QRF10_RS01585 (QRF10_01585) | 363475..363777 | + | 303 | WP_003401560.1 | toxin-antitoxin system toxin | - |
QRF10_RS01590 (QRF10_01590) | 363825..364046 | + | 222 | WP_003401563.1 | type II toxin-antitoxin system antitoxin VapB2 | Antitoxin |
QRF10_RS01595 (QRF10_01595) | 364043..364468 | + | 426 | WP_003401566.1 | PIN domain nuclease | Toxin |
QRF10_RS01600 (QRF10_01600) | 364604..365236 | + | 633 | WP_003401571.1 | TetR/AcrR family transcriptional regulator | - |
QRF10_RS01605 (QRF10_01605) | 365233..366141 | + | 909 | WP_003900117.1 | protochlorophyllide reductase | - |
QRF10_RS01610 (QRF10_01610) | 366149..366739 | - | 591 | WP_229298012.1 | hypothetical protein | - |
QRF10_RS01615 (QRF10_01615) | 366732..366782 | - | 51 | Protein_319 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15713.90 Da Isoelectric Point: 5.6002
>T283810 WP_003401566.1 NZ_CP127274:364043-364468 [Mycobacterium tuberculosis]
VTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRAL
EVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA
VTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRAL
EVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 3H87 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 3H87 | |
AlphaFold DB | A0A829CG48 |