Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3166115..3166802 | Replicon | chromosome |
| Accession | NZ_CP127273 | ||
| Organism | Mycobacterium tuberculosis strain 3320 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P65044 |
| Locus tag | QQ046_RS15110 | Protein ID | WP_003414624.1 |
| Coordinates | 3166359..3166802 (+) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TFH0 |
| Locus tag | QQ046_RS15105 | Protein ID | WP_003414620.1 |
| Coordinates | 3166115..3166372 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ046_RS15085 (QQ046_15085) | 3161435..3162289 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
| QQ046_RS15090 (QQ046_15090) | 3162345..3163508 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
| QQ046_RS15095 (QQ046_15095) | 3163525..3164739 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
| QQ046_RS15100 (QQ046_15100) | 3164747..3165988 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
| QQ046_RS15105 (QQ046_15105) | 3166115..3166372 | + | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| QQ046_RS15110 (QQ046_15110) | 3166359..3166802 | + | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QQ046_RS15115 (QQ046_15115) | 3166882..3167544 | + | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
| QQ046_RS15120 (QQ046_15120) | 3167640..3167831 | + | 192 | WP_003414632.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| QQ046_RS15125 (QQ046_15125) | 3168163..3169911 | + | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
| QQ046_RS15130 (QQ046_15130) | 3170007..3170588 | + | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
| QQ046_RS15135 (QQ046_15135) | 3170688..3170954 | + | 267 | WP_015456449.1 | DUF2631 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T283801 WP_003414624.1 NZ_CP127273:3166359-3166802 [Mycobacterium tuberculosis]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|