Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 3119597..3120201 Replicon chromosome
Accession NZ_CP127273
Organism Mycobacterium tuberculosis strain 3320

Toxin (Protein)


Gene name vapC Uniprot ID P71623
Locus tag QQ046_RS14880 Protein ID WP_003414492.1
Coordinates 3119597..3119989 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A829CBY8
Locus tag QQ046_RS14885 Protein ID WP_003414495.1
Coordinates 3119986..3120201 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQ046_RS14850 (QQ046_14850) 3114747..3115535 - 789 WP_003917092.1 CRISPR-associated endoribonuclease Cas6 -
QQ046_RS14855 (QQ046_14855) 3115869..3116414 - 546 WP_014584866.1 DUF1802 family protein -
QQ046_RS14860 (QQ046_14860) 3116686..3117570 - 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QQ046_RS14865 (QQ046_14865) 3117573..3118460 - 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
QQ046_RS14870 (QQ046_14870) 3118765..3119310 - 546 WP_003910939.1 DUF1802 family protein -
QQ046_RS14875 (QQ046_14875) 3119307..3119576 - 270 WP_003414489.1 DUF2277 family protein -
QQ046_RS14880 (QQ046_14880) 3119597..3119989 - 393 WP_003414492.1 type II toxin-antitoxin system VapC family toxin Toxin
QQ046_RS14885 (QQ046_14885) 3119986..3120201 - 216 WP_003414495.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QQ046_RS14890 (QQ046_14890) 3120248..3120997 + 750 WP_003902358.1 enoyl-CoA hydratase -
QQ046_RS14895 (QQ046_14895) 3121076..3122158 - 1083 WP_003414499.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC -
QQ046_RS14900 (QQ046_14900) 3122151..3123461 - 1311 WP_003414501.1 ABC transporter substrate-binding protein -
QQ046_RS14905 (QQ046_14905) 3123464..3124291 - 828 WP_003414504.1 carbohydrate ABC transporter permease -
QQ046_RS14910 (QQ046_14910) 3124288..3125199 - 912 WP_003414505.1 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-130)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14610.74 Da        Isoelectric Point: 6.7594

>T283799 WP_003414492.1 NZ_CP127273:c3119989-3119597 [Mycobacterium tuberculosis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7511.55 Da        Isoelectric Point: 4.9732

>AT283799 WP_003414495.1 NZ_CP127273:c3120201-3119986 [Mycobacterium tuberculosis]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BWM8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CBY8

References