Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 3053565..3054252 Replicon chromosome
Accession NZ_CP127273
Organism Mycobacterium tuberculosis strain 3320

Toxin (Protein)


Gene name vapC Uniprot ID G0TF65
Locus tag QQ046_RS14510 Protein ID WP_003414064.1
Coordinates 3053857..3054252 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TF64
Locus tag QQ046_RS14505 Protein ID WP_003414061.1
Coordinates 3053565..3053831 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQ046_RS14480 (QQ046_14480) 3049204..3050106 - 903 WP_003900564.1 4-hydroxy-tetrahydrodipicolinate synthase -
QQ046_RS14485 (QQ046_14485) 3050175..3050927 - 753 WP_003899465.1 FAD-dependent thymidylate synthase -
QQ046_RS14490 (QQ046_14490) 3051171..3051446 - 276 WP_003414055.1 type I restriction endonuclease subunit S -
QQ046_RS14495 (QQ046_14495) 3051443..3053065 - 1623 WP_003414057.1 class I SAM-dependent DNA methyltransferase -
QQ046_RS14500 (QQ046_14500) 3053152..3053568 - 417 WP_003414059.1 type II toxin-antitoxin system toxin ribonuclease C21 -
QQ046_RS14505 (QQ046_14505) 3053565..3053831 - 267 WP_003414061.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QQ046_RS14510 (QQ046_14510) 3053857..3054252 - 396 WP_003414064.1 type II toxin-antitoxin system VapC family toxin Toxin
QQ046_RS14515 (QQ046_14515) 3054249..3054518 - 270 WP_003414066.1 type II toxin-antitoxin system VapB family antitoxin -
QQ046_RS14520 (QQ046_14520) 3054528..3055622 - 1095 WP_003414068.1 restriction endonuclease subunit S -
QQ046_RS14525 (QQ046_14525) 3055619..3056038 - 420 WP_003414070.1 winged helix-turn-helix domain-containing protein -
QQ046_RS14530 (QQ046_14530) 3056037..3056111 + 75 Protein_2867 hypothetical protein -
QQ046_RS14535 (QQ046_14535) 3056112..3056591 - 480 WP_003414073.1 dihydrofolate reductase -
QQ046_RS14540 (QQ046_14540) 3056662..3057462 - 801 WP_003911953.1 thymidylate synthase -
QQ046_RS14545 (QQ046_14545) 3057618..3058355 + 738 WP_003414079.1 dienelactone hydrolase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-125)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(16-56)


Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14340.04 Da        Isoelectric Point: 4.7145

>T283796 WP_003414064.1 NZ_CP127273:c3054252-3053857 [Mycobacterium tuberculosis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT

Download         Length: 396 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9493.77 Da        Isoelectric Point: 7.2783

>AT283796 WP_003414061.1 NZ_CP127273:c3053831-3053565 [Mycobacterium tuberculosis]
MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMNRMAENATGTQDEALVNAMWR
DGHPENTA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TF65

Antitoxin

Source ID Structure
AlphaFold DB G0TF64

References