Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2913052..2913766 Replicon chromosome
Accession NZ_CP127273
Organism Mycobacterium tuberculosis strain 3320

Toxin (Protein)


Gene name vapC Uniprot ID G0TQK0
Locus tag QQ046_RS13680 Protein ID WP_003413460.1
Coordinates 2913326..2913766 (+) Length 147 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ20
Locus tag QQ046_RS13675 Protein ID WP_003413456.1
Coordinates 2913052..2913339 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQ046_RS13640 (QQ046_13640) 2908474..2908719 + 246 WP_003413429.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
QQ046_RS13645 (QQ046_13645) 2908716..2909120 + 405 WP_003413432.1 type II toxin-antitoxin system VapC family toxin -
QQ046_RS13650 (QQ046_13650) 2909337..2909957 + 621 WP_003413441.1 DUF4178 domain-containing protein -
QQ046_RS13655 (QQ046_13655) 2909968..2910462 + 495 WP_003413444.1 DUF2617 family protein -
QQ046_RS13660 (QQ046_13660) 2910459..2910890 + 432 WP_003899390.1 DUF4247 domain-containing protein -
QQ046_RS13665 (QQ046_13665) 2910915..2911373 + 459 WP_003413451.1 DUF350 domain-containing protein -
QQ046_RS13670 (QQ046_13670) 2911370..2912941 + 1572 WP_003899392.1 polyamine aminopropyltransferase -
QQ046_RS13675 (QQ046_13675) 2913052..2913339 + 288 WP_003413456.1 antitoxin VapB41 Antitoxin
QQ046_RS13680 (QQ046_13680) 2913326..2913766 + 441 WP_003413460.1 type II toxin-antitoxin system VapC family toxin Toxin
QQ046_RS13685 (QQ046_13685) 2913787..2914542 - 756 WP_003413464.1 YebC/PmpR family DNA-binding transcriptional regulator -
QQ046_RS13690 (QQ046_13690) 2914675..2915271 - 597 WP_003413465.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
QQ046_RS13695 (QQ046_13695) 2915279..2916124 - 846 WP_003413466.1 acyl-CoA thioesterase II -
QQ046_RS13700 (QQ046_13700) 2916153..2917052 - 900 WP_003413468.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
QQ046_RS13705 (QQ046_13705) 2917180..2917854 + 675 WP_003413471.1 pyridoxamine 5'-phosphate oxidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-146)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 147 a.a.        Molecular weight: 16026.38 Da        Isoelectric Point: 6.8599

>T283793 WP_003413460.1 NZ_CP127273:2913326-2913766 [Mycobacterium tuberculosis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK

Download         Length: 441 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10453.98 Da        Isoelectric Point: 7.2797

>AT283793 WP_003413456.1 NZ_CP127273:2913052-2913339 [Mycobacterium tuberculosis]
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALL
DQEAQWWSGHDDAAL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQK0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BWB8

References