Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 2851136..2851845 Replicon chromosome
Accession NZ_CP127273
Organism Mycobacterium tuberculosis strain 3320

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ26
Locus tag QQ046_RS13395 Protein ID WP_003413164.1
Coordinates 2851136..2851549 (+) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag QQ046_RS13400 Protein ID WP_003413167.1
Coordinates 2851588..2851845 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQ046_RS13365 (QQ046_13365) 2846189..2847394 - 1206 WP_003413027.1 chorismate synthase -
QQ046_RS13370 (QQ046_13370) 2847502..2847816 + 315 WP_009937839.1 hypothetical protein -
QQ046_RS13375 (QQ046_13375) 2848112..2849323 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
QQ046_RS13380 (QQ046_13380) 2849450..2850109 + 660 WP_286014908.1 LppA family lipoprotein -
QQ046_RS13385 (QQ046_13385) 2850106..2850768 + 663 WP_286014909.1 LppA family lipoprotein -
QQ046_RS13390 (QQ046_13390) 2850765..2851043 + 279 WP_041018915.1 type II toxin-antitoxin system VapB family antitoxin -
QQ046_RS13395 (QQ046_13395) 2851136..2851549 + 414 WP_003413164.1 PIN domain nuclease Toxin
QQ046_RS13400 (QQ046_13400) 2851588..2851845 + 258 WP_003413167.1 CopG family transcriptional regulator Antitoxin
QQ046_RS13405 (QQ046_13405) 2851842..2852219 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin -
QQ046_RS13410 (QQ046_13410) 2852235..2852609 - 375 WP_003413177.1 hypothetical protein -
QQ046_RS13415 (QQ046_13415) 2852709..2853104 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
QQ046_RS13420 (QQ046_13420) 2853101..2853346 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
QQ046_RS13425 (QQ046_13425) 2853757..2854176 - 420 WP_003413190.1 A24 family peptidase -
QQ046_RS13430 (QQ046_13430) 2854188..2854997 - 810 WP_003413193.1 shikimate dehydrogenase -
QQ046_RS13435 (QQ046_13435) 2854994..2856247 - 1254 WP_003413196.1 endolytic transglycosylase MltG -
QQ046_RS13440 (QQ046_13440) 2856240..2856752 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-122)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 15045.00 Da        Isoelectric Point: 5.4673

>T283790 WP_003413164.1 NZ_CP127273:2851136-2851549 [Mycobacterium tuberculosis]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL

Download         Length: 414 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT283790 WP_003413167.1 NZ_CP127273:2851588-2851845 [Mycobacterium tuberculosis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ26

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References