Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2837249..2837889 | Replicon | chromosome |
Accession | NZ_CP127273 | ||
Organism | Mycobacterium tuberculosis strain 3320 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQ08 |
Locus tag | QQ046_RS13310 | Protein ID | WP_003412970.1 |
Coordinates | 2837249..2837668 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ09 |
Locus tag | QQ046_RS13315 | Protein ID | WP_003412975.1 |
Coordinates | 2837665..2837889 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ046_RS13280 (QQ046_13280) | 2832834..2833556 | - | 723 | WP_003412957.1 | DUF1906 domain-containing protein | - |
QQ046_RS13285 (QQ046_13285) | 2834073..2834300 | + | 228 | WP_003412960.1 | type II toxin-antitoxin system VapB family antitoxin | - |
QQ046_RS13290 (QQ046_13290) | 2834297..2834698 | + | 402 | WP_003412963.1 | PIN domain-containing protein | - |
QQ046_RS13295 (QQ046_13295) | 2834733..2835653 | - | 921 | WP_003412965.1 | restriction endonuclease | - |
QQ046_RS13300 (QQ046_13300) | 2835994..2836239 | - | 246 | WP_071854223.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
QQ046_RS13305 (QQ046_13305) | 2836298..2837248 | + | 951 | WP_003911916.1 | ERCC4 domain-containing protein | - |
QQ046_RS13310 (QQ046_13310) | 2837249..2837668 | - | 420 | WP_003412970.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QQ046_RS13315 (QQ046_13315) | 2837665..2837889 | - | 225 | WP_003412975.1 | antitoxin VapB39 | Antitoxin |
QQ046_RS13320 (QQ046_13320) | 2837920..2840763 | - | 2844 | WP_003899363.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
QQ046_RS13325 (QQ046_13325) | 2840835..2841236 | - | 402 | WP_003412981.1 | hypothetical protein | - |
QQ046_RS13330 (QQ046_13330) | 2841236..2841706 | - | 471 | WP_003899364.1 | transcription antitermination factor NusB | - |
QQ046_RS13335 (QQ046_13335) | 2841709..2842272 | - | 564 | WP_003412989.1 | elongation factor P | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14732.70 Da Isoelectric Point: 6.7519
>T283789 WP_003412970.1 NZ_CP127273:c2837668-2837249 [Mycobacterium tuberculosis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|