Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 2385175..2385704 Replicon chromosome
Accession NZ_CP127273
Organism Mycobacterium tuberculosis strain 3320

Toxin (Protein)


Gene name parE Uniprot ID G0TMR4
Locus tag QQ046_RS11195 Protein ID WP_003411124.1
Coordinates 2385175..2385492 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P9WJ74
Locus tag QQ046_RS11200 Protein ID WP_003411127.1
Coordinates 2385489..2385704 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQ046_RS11165 (QQ046_11165) 2380312..2381388 + 1077 WP_003411110.1 hypothetical protein -
QQ046_RS11170 (QQ046_11170) 2381385..2381666 + 282 WP_003411112.1 DUF5703 family protein -
QQ046_RS11175 (QQ046_11175) 2381702..2382775 + 1074 WP_003901338.1 quinone-dependent dihydroorotate dehydrogenase -
QQ046_RS11180 (QQ046_11180) 2382780..2383310 - 531 WP_003411119.1 YbhB/YbcL family Raf kinase inhibitor-like protein -
QQ046_RS11185 (QQ046_11185) 2383358..2384704 - 1347 WP_003411121.1 M20/M25/M40 family metallo-hydrolase -
QQ046_RS11195 (QQ046_11195) 2385175..2385492 - 318 WP_003411124.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QQ046_RS11200 (QQ046_11200) 2385489..2385704 - 216 WP_003411127.1 antitoxin ParD2 Antitoxin
QQ046_RS11205 (QQ046_11205) 2385959..2387017 + 1059 WP_003411129.1 phosphoribosyltransferase family protein -
QQ046_RS11210 (QQ046_11210) 2387147..2387503 - 357 WP_003411130.1 hypothetical protein -
QQ046_RS11215 (QQ046_11215) 2387598..2388380 - 783 WP_003411131.1 cell wall synthesis protein Wag31 -
QQ046_RS11220 (QQ046_11220) 2388648..2388938 - 291 WP_003900476.1 YggT family protein -
QQ046_RS11225 (QQ046_11225) 2389100..2389756 - 657 WP_003411133.1 cell division protein SepF -
QQ046_RS11230 (QQ046_11230) 2389822..2390598 - 777 WP_003411137.1 YggS family pyridoxal phosphate-dependent enzyme -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Conserved hypothetical protein CHP02574, addiction module

(11-69)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12312.88 Da        Isoelectric Point: 6.4831

>T283787 WP_003411124.1 NZ_CP127273:c2385492-2385175 [Mycobacterium tuberculosis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE

Download         Length: 318 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7880.70 Da        Isoelectric Point: 4.4055

>AT283787 WP_003411127.1 NZ_CP127273:c2385704-2385489 [Mycobacterium tuberculosis]
VVVNRALLASVDALSRDEQIELVEHINGNLAEGMHISEANQALIEARANDTDDAHWSTIDDFDKRIRARLG

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TMR4

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4FAJ4

References