Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2347068..2347763 | Replicon | chromosome |
| Accession | NZ_CP127273 | ||
| Organism | Mycobacterium tuberculosis strain 3320 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QQ046_RS10985 | Protein ID | WP_003905754.1 |
| Coordinates | 2347068..2347502 (-) | Length | 145 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TMN0 |
| Locus tag | QQ046_RS10990 | Protein ID | WP_003410814.1 |
| Coordinates | 2347509..2347763 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ046_RS10975 (QQ046_10975) | 2343222..2346263 | + | 3042 | WP_003899171.1 | DEAD/DEAH box helicase | - |
| QQ046_RS10980 (QQ046_10980) | 2346256..2347089 | + | 834 | WP_003899172.1 | SWIM zinc finger family protein | - |
| QQ046_RS10985 (QQ046_10985) | 2347068..2347502 | - | 435 | WP_003905754.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QQ046_RS10990 (QQ046_10990) | 2347509..2347763 | - | 255 | WP_003410814.1 | antitoxin | Antitoxin |
| QQ046_RS10995 (QQ046_10995) | 2347779..2348036 | - | 258 | WP_003410816.1 | hypothetical protein | - |
| QQ046_RS11000 (QQ046_11000) | 2348447..2349708 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
| QQ046_RS11005 (QQ046_11005) | 2350341..2350637 | + | 297 | WP_003410820.1 | PE family protein | - |
| QQ046_RS11010 (QQ046_11010) | 2350693..2351424 | + | 732 | WP_003900467.1 | PPE family protein | - |
| QQ046_RS11015 (QQ046_11015) | 2351965..2352711 | - | 747 | WP_003901330.1 | proteasome subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15632.05 Da Isoelectric Point: 7.4681
>T283786 WP_003905754.1 NZ_CP127273:c2347502-2347068 [Mycobacterium tuberculosis]
MKIVDANVLLYAVNTASEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
MKIVDANVLLYAVNTASEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|