Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1685579..1686195 | Replicon | chromosome |
| Accession | NZ_CP127273 | ||
| Organism | Mycobacterium tuberculosis strain 3320 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TJ74 |
| Locus tag | QQ046_RS07945 | Protein ID | WP_003407593.1 |
| Coordinates | 1685878..1686195 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TJ73 |
| Locus tag | QQ046_RS07940 | Protein ID | WP_003900349.1 |
| Coordinates | 1685579..1685881 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ046_RS07930 (QQ046_07930) | 1681465..1683312 | + | 1848 | WP_003407585.1 | methylmalonyl-CoA mutase small subunit | - |
| QQ046_RS07935 (QQ046_07935) | 1683313..1685565 | + | 2253 | WP_003407587.1 | methylmalonyl-CoA mutase | - |
| QQ046_RS07940 (QQ046_07940) | 1685579..1685881 | + | 303 | WP_003900349.1 | type II toxin-antitoxin system antitoxin MazE4 | Antitoxin |
| QQ046_RS07945 (QQ046_07945) | 1685878..1686195 | + | 318 | WP_003407593.1 | type II toxin-antitoxin system toxin endoribonuclease MazF4 | Toxin |
| QQ046_RS07950 (QQ046_07950) | 1686192..1687196 | + | 1005 | WP_003407596.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
| QQ046_RS07955 (QQ046_07955) | 1687249..1688538 | + | 1290 | WP_003902090.1 | serine hydrolase domain-containing protein | - |
| QQ046_RS07960 (QQ046_07960) | 1688611..1689336 | - | 726 | WP_003898898.1 | class I SAM-dependent methyltransferase | - |
| QQ046_RS07965 (QQ046_07965) | 1689442..1689654 | - | 213 | WP_003898900.1 | dodecin family protein | - |
| QQ046_RS07970 (QQ046_07970) | 1689715..1690113 | + | 399 | WP_003900351.1 | hypothetical protein | - |
| QQ046_RS07975 (QQ046_07975) | 1690158..1691186 | + | 1029 | WP_003407612.1 | glycosyltransferase family 2 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11377.97 Da Isoelectric Point: 7.9950
>T283773 WP_003407593.1 NZ_CP127273:1685878-1686195 [Mycobacterium tuberculosis]
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|