Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-Phd |
| Location | 1387993..1388552 | Replicon | chromosome |
| Accession | NZ_CP127273 | ||
| Organism | Mycobacterium tuberculosis strain 3320 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G0THS1 |
| Locus tag | QQ046_RS06640 | Protein ID | WP_003898789.1 |
| Coordinates | 1387993..1388286 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G0THS2 |
| Locus tag | QQ046_RS06645 | Protein ID | WP_003406322.1 |
| Coordinates | 1388283..1388552 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ046_RS06615 (QQ046_06615) | 1383586..1383846 | + | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | - |
| QQ046_RS06620 (QQ046_06620) | 1383843..1384274 | + | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | - |
| QQ046_RS06625 (QQ046_06625) | 1384297..1385985 | - | 1689 | WP_286014938.1 | PE family protein | - |
| QQ046_RS06630 (QQ046_06630) | 1386165..1387025 | + | 861 | WP_003900301.1 | glycine betaine ABC transporter substrate-binding protein | - |
| QQ046_RS06635 (QQ046_06635) | 1387106..1387936 | - | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| QQ046_RS06640 (QQ046_06640) | 1387993..1388286 | - | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| QQ046_RS06645 (QQ046_06645) | 1388283..1388552 | - | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QQ046_RS06650 (QQ046_06650) | 1388665..1392360 | - | 3696 | WP_003406323.1 | multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit | - |
| QQ046_RS06655 (QQ046_06655) | 1392502..1393290 | - | 789 | WP_003406325.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11031.57 Da Isoelectric Point: 9.6275
>T283770 WP_003898789.1 NZ_CP127273:c1388286-1387993 [Mycobacterium tuberculosis]
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|