Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 1238724..1239292 Replicon chromosome
Accession NZ_CP127273
Organism Mycobacterium tuberculosis strain 3320

Toxin (Protein)


Gene name vapC Uniprot ID G0TH08
Locus tag QQ046_RS05945 Protein ID WP_003405865.1
Coordinates 1238918..1239292 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TH07
Locus tag QQ046_RS05940 Protein ID WP_003405863.1
Coordinates 1238724..1238921 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQ046_RS05920 (QQ046_05920) 1234765..1235403 - 639 WP_003898730.1 lipid droplet-associated protein -
QQ046_RS05925 (QQ046_05925) 1235493..1236500 + 1008 WP_003405853.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
QQ046_RS05930 (QQ046_05930) 1236517..1237500 - 984 WP_003898731.1 hypothetical protein -
QQ046_RS05935 (QQ046_05935) 1237563..1238636 + 1074 WP_003898732.1 redox-regulated ATPase YchF -
QQ046_RS05940 (QQ046_05940) 1238724..1238921 + 198 WP_003405863.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QQ046_RS05945 (QQ046_05945) 1238918..1239292 + 375 WP_003405865.1 type II toxin-antitoxin system VapC family toxin Toxin
QQ046_RS05950 (QQ046_05950) 1239495..1240193 + 699 WP_003898733.1 hypothetical protein -
QQ046_RS05955 (QQ046_05955) 1240311..1240496 + 186 WP_003901093.1 hypothetical protein -
QQ046_RS05960 (QQ046_05960) 1240423..1240698 - 276 WP_003405867.1 hypothetical protein -
QQ046_RS05965 (QQ046_05965) 1240941..1241264 + 324 WP_003405871.1 putative quinol monooxygenase -
QQ046_RS05970 (QQ046_05970) 1241279..1241977 - 699 WP_031646953.1 hypothetical protein -
QQ046_RS05975 (QQ046_05975) 1242011..1242220 + 210 WP_003911400.1 hypothetical protein -
QQ046_RS05980 (QQ046_05980) 1242172..1242942 - 771 Protein_1178 adenylate/guanylate cyclase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-111)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13444.56 Da        Isoelectric Point: 5.1881

>T283768 WP_003405865.1 NZ_CP127273:1238918-1239292 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS

Download         Length: 375 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 6973.03 Da        Isoelectric Point: 11.7327

>AT283768 WP_003405863.1 NZ_CP127273:1238724-1238921 [Mycobacterium tuberculosis]
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TH08

Antitoxin

Source ID Structure
AlphaFold DB G0TH07

References