Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1229968..1230599 | Replicon | chromosome |
| Accession | NZ_CP127273 | ||
| Organism | Mycobacterium tuberculosis strain 3320 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A7U4F9D0 |
| Locus tag | QQ046_RS05890 | Protein ID | WP_003405820.1 |
| Coordinates | 1229968..1230279 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TGZ7 |
| Locus tag | QQ046_RS05895 | Protein ID | WP_003405836.1 |
| Coordinates | 1230279..1230599 (-) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ046_RS05870 (QQ046_05870) | 1225449..1226873 | - | 1425 | WP_003405805.1 | class II fumarate hydratase | - |
| QQ046_RS05875 (QQ046_05875) | 1226904..1227992 | - | 1089 | WP_003898726.1 | class II fructose-bisphosphatase | - |
| QQ046_RS05880 (QQ046_05880) | 1228048..1228692 | + | 645 | WP_003915494.1 | DUF4245 domain-containing protein | - |
| QQ046_RS05885 (QQ046_05885) | 1228699..1229856 | - | 1158 | WP_003898727.1 | AI-2E family transporter | - |
| QQ046_RS05890 (QQ046_05890) | 1229968..1230279 | - | 312 | WP_003405820.1 | type II toxin-antitoxin system toxin endoribonuclease MazF3 | Toxin |
| QQ046_RS05895 (QQ046_05895) | 1230279..1230599 | - | 321 | WP_003405836.1 | type II toxin-antitoxin system antitoxin MazE3 | Antitoxin |
| QQ046_RS05900 (QQ046_05900) | 1230609..1232145 | + | 1537 | Protein_1162 | carboxylesterase/lipase family protein | - |
| QQ046_RS05905 (QQ046_05905) | 1232152..1233264 | - | 1113 | WP_003405840.1 | 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase | - |
| QQ046_RS05910 (QQ046_05910) | 1233274..1233531 | - | 258 | WP_003405844.1 | exodeoxyribonuclease VII small subunit | - |
| QQ046_RS05915 (QQ046_05915) | 1233521..1234768 | - | 1248 | WP_003405846.1 | exodeoxyribonuclease VII large subunit | - |
| QQ046_RS05920 (QQ046_05920) | 1234765..1235403 | - | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11061.82 Da Isoelectric Point: 4.9371
>T283767 WP_003405820.1 NZ_CP127273:c1230279-1229968 [Mycobacterium tuberculosis]
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4F9D0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TGZ7 |