Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 840255..840964 | Replicon | chromosome |
| Accession | NZ_CP127273 | ||
| Organism | Mycobacterium tuberculosis strain 3320 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WF74 |
| Locus tag | QQ046_RS03970 | Protein ID | WP_003403837.1 |
| Coordinates | 840536..840964 (+) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TEX4 |
| Locus tag | QQ046_RS03965 | Protein ID | WP_003403834.1 |
| Coordinates | 840255..840512 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ046_RS03960 (QQ046_03960) | 837759..840164 | + | 2406 | WP_286014933.1 | PE family protein | - |
| QQ046_RS03965 (QQ046_03965) | 840255..840512 | + | 258 | WP_003403834.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| QQ046_RS03970 (QQ046_03970) | 840536..840964 | + | 429 | WP_003403837.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QQ046_RS03975 (QQ046_03975) | 841045..841182 | - | 138 | WP_003403839.1 | hypothetical protein | - |
| QQ046_RS03980 (QQ046_03980) | 841341..841586 | + | 246 | WP_003403841.1 | hypothetical protein | - |
| QQ046_RS03985 (QQ046_03985) | 841655..842539 | - | 885 | WP_003403844.1 | 3-hydroxyisobutyrate dehydrogenase | - |
| QQ046_RS03990 (QQ046_03990) | 842550..843722 | - | 1173 | WP_003403845.1 | acyl-CoA dehydrogenase family protein | - |
| QQ046_RS03995 (QQ046_03995) | 843729..845261 | - | 1533 | WP_003403847.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15831.27 Da Isoelectric Point: 7.5536
>T283763 WP_003403837.1 NZ_CP127273:840536-840964 [Mycobacterium tuberculosis]
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CDR3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TEX4 |