Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 752292..752925 Replicon chromosome
Accession NZ_CP127273
Organism Mycobacterium tuberculosis strain 3320

Toxin (Protein)


Gene name vapC Uniprot ID G0TQD6
Locus tag QQ046_RS03465 Protein ID WP_003403365.1
Coordinates 752292..752675 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ56
Locus tag QQ046_RS03470 Protein ID WP_003403368.1
Coordinates 752770..752925 (-) Length 52 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQ046_RS03440 (QQ046_03440) 747584..748120 + 537 WP_003403341.1 50S ribosomal protein L10 -
QQ046_RS03445 (QQ046_03445) 748157..748549 + 393 WP_003403353.1 50S ribosomal protein L7/L12 -
QQ046_RS03450 (QQ046_03450) 748542..749237 - 696 WP_003403355.1 TetR/AcrR family transcriptional regulator -
QQ046_RS03455 (QQ046_03455) 749308..750813 + 1506 WP_003403360.1 carotenoid cleavage oxygenase -
QQ046_RS03460 (QQ046_03460) 750894..751904 + 1011 WP_003911248.1 ABC transporter ATP-binding protein -
QQ046_RS03465 (QQ046_03465) 752292..752675 - 384 WP_003403365.1 ribonuclease VapC6 Toxin
QQ046_RS03470 (QQ046_03470) 752770..752925 - 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QQ046_RS03475 (QQ046_03475) 753001..753717 - 717 WP_003403371.1 CPBP family intramembrane metalloprotease -
QQ046_RS03480 (QQ046_03480) 753993..754301 - 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin -
QQ046_RS03485 (QQ046_03485) 754288..754533 - 246 WP_003403381.1 ribbon-helix-helix protein, CopG family -
QQ046_RS03490 (QQ046_03490) 754643..755080 - 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin -
QQ046_RS03495 (QQ046_03495) 755077..755331 - 255 WP_003911263.1 antitoxin VapB7 -
QQ046_RS03500 (QQ046_03500) 755445..757808 + 2364 WP_003901895.1 arylsulfatase AtsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(3-44)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 13959.73 Da        Isoelectric Point: 6.0803

>T283759 WP_003403365.1 NZ_CP127273:c752675-752292 [Mycobacterium tuberculosis]
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD

Download         Length: 384 bp

Antitoxin


Download         Length: 52 a.a.        Molecular weight: 5872.72 Da        Isoelectric Point: 5.7734

>AT283759 WP_003403368.1 NZ_CP127273:c752925-752770 [Mycobacterium tuberculosis]
VSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE

Download         Length: 156 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQD6

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BSF8

References