Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 715718..716367 | Replicon | chromosome |
| Accession | NZ_CP127273 | ||
| Organism | Mycobacterium tuberculosis strain 3320 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P67241 |
| Locus tag | QQ046_RS03280 | Protein ID | WP_003403236.1 |
| Coordinates | 715972..716367 (+) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ34 |
| Locus tag | QQ046_RS03275 | Protein ID | WP_003403235.1 |
| Coordinates | 715718..715972 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ046_RS03250 (QQ046_03250) | 710844..710927 | + | 84 | Protein_644 | galactose-1-phosphate uridylyltransferase | - |
| QQ046_RS03255 (QQ046_03255) | 710946..712027 | + | 1082 | Protein_645 | galactose-1-phosphate uridylyltransferase | - |
| QQ046_RS03260 (QQ046_03260) | 712024..713115 | + | 1092 | WP_003900977.1 | galactokinase | - |
| QQ046_RS03265 (QQ046_03265) | 713510..714574 | + | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
| QQ046_RS03270 (QQ046_03270) | 714678..715625 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
| QQ046_RS03275 (QQ046_03275) | 715718..715972 | + | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | Antitoxin |
| QQ046_RS03280 (QQ046_03280) | 715972..716367 | + | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | Toxin |
| QQ046_RS03285 (QQ046_03285) | 716461..717201 | - | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
| QQ046_RS03290 (QQ046_03290) | 717333..717593 | + | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QQ046_RS03295 (QQ046_03295) | 717590..717997 | + | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | - |
| QQ046_RS03300 (QQ046_03300) | 718069..719220 | - | 1152 | WP_003403248.1 | FIST N-terminal domain-containing protein | - |
| QQ046_RS03305 (QQ046_03305) | 719313..721040 | - | 1728 | WP_003901883.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14250.04 Da Isoelectric Point: 4.7475
>T283757 WP_003403236.1 NZ_CP127273:715972-716367 [Mycobacterium tuberculosis]
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4XGR | |
| PDB | 4XGQ |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4XGR | |
| PDB | 4XGQ | |
| AlphaFold DB | A0A7U4BSC2 |