Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 710090..710715 | Replicon | chromosome |
| Accession | NZ_CP127273 | ||
| Organism | Mycobacterium tuberculosis strain 3320 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQA0 |
| Locus tag | QQ046_RS03245 | Protein ID | WP_003403218.1 |
| Coordinates | 710314..710715 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ36 |
| Locus tag | QQ046_RS03240 | Protein ID | WP_003403213.1 |
| Coordinates | 710090..710317 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ046_RS03215 (QQ046_03215) | 705269..705490 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
| QQ046_RS03220 (QQ046_03220) | 705632..706237 | + | 606 | WP_003898526.1 | hypothetical protein | - |
| QQ046_RS03225 (QQ046_03225) | 706256..708823 | - | 2568 | WP_003901879.1 | SEC-C metal-binding domain-containing protein | - |
| QQ046_RS03230 (QQ046_03230) | 708907..709656 | + | 750 | WP_003898528.1 | hypothetical protein | - |
| QQ046_RS03235 (QQ046_03235) | 709653..709895 | + | 243 | WP_003403210.1 | hypothetical protein | - |
| QQ046_RS03240 (QQ046_03240) | 710090..710317 | + | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
| QQ046_RS03245 (QQ046_03245) | 710314..710715 | + | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
| QQ046_RS03250 (QQ046_03250) | 710844..710927 | + | 84 | Protein_644 | galactose-1-phosphate uridylyltransferase | - |
| QQ046_RS03255 (QQ046_03255) | 710946..712027 | + | 1082 | Protein_645 | galactose-1-phosphate uridylyltransferase | - |
| QQ046_RS03260 (QQ046_03260) | 712024..713115 | + | 1092 | WP_003900977.1 | galactokinase | - |
| QQ046_RS03265 (QQ046_03265) | 713510..714574 | + | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
| QQ046_RS03270 (QQ046_03270) | 714678..715625 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T283756 WP_003403218.1 NZ_CP127273:710314-710715 [Mycobacterium tuberculosis]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQA0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSC9 |