Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 702552..703195 | Replicon | chromosome |
| Accession | NZ_CP127273 | ||
| Organism | Mycobacterium tuberculosis strain 3320 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P67239 |
| Locus tag | QQ046_RS03195 | Protein ID | WP_003403187.1 |
| Coordinates | 702794..703195 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TQ91 |
| Locus tag | QQ046_RS03190 | Protein ID | WP_003403184.1 |
| Coordinates | 702552..702797 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ046_RS03155 (QQ046_03155) | 697832..698362 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
| QQ046_RS03160 (QQ046_03160) | 698346..699041 | - | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
| QQ046_RS03165 (QQ046_03165) | 699164..699475 | + | 312 | WP_003403164.1 | hypothetical protein | - |
| QQ046_RS03170 (QQ046_03170) | 699547..700497 | + | 951 | WP_003900184.1 | DUF1259 domain-containing protein | - |
| QQ046_RS03175 (QQ046_03175) | 700738..701322 | + | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
| QQ046_RS03180 (QQ046_03180) | 701324..702034 | + | 711 | Protein_630 | IS607 family element RNA-guided endonuclease TnpB | - |
| QQ046_RS03185 (QQ046_03185) | 702037..702507 | + | 471 | WP_003898523.1 | hypothetical protein | - |
| QQ046_RS03190 (QQ046_03190) | 702552..702797 | + | 246 | WP_003403184.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QQ046_RS03195 (QQ046_03195) | 702794..703195 | + | 402 | WP_003403187.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QQ046_RS03200 (QQ046_03200) | 703186..703365 | + | 180 | Protein_634 | hypothetical protein | - |
| QQ046_RS03205 (QQ046_03205) | 703783..703980 | - | 198 | WP_003403191.1 | hypothetical protein | - |
| QQ046_RS03210 (QQ046_03210) | 704060..705217 | - | 1158 | WP_003898524.1 | hypothetical protein | - |
| QQ046_RS03215 (QQ046_03215) | 705269..705490 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
| QQ046_RS03220 (QQ046_03220) | 705632..706237 | + | 606 | WP_003898526.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14501.21 Da Isoelectric Point: 4.4463
>T283755 WP_003403187.1 NZ_CP127273:702794-703195 [Mycobacterium tuberculosis]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSD6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ91 |