Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/AbrB(antitoxin)
Location 696462..697108 Replicon chromosome
Accession NZ_CP127273
Organism Mycobacterium tuberculosis strain 3320

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ88
Locus tag QQ046_RS03140 Protein ID WP_003403137.1
Coordinates 696462..696875 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ89
Locus tag QQ046_RS03145 Protein ID WP_003403139.1
Coordinates 696872..697108 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQ046_RS03120 (QQ046_03120) 692545..694095 + 1551 WP_003905349.1 MCE family protein -
QQ046_RS03125 (QQ046_03125) 694147..694539 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 -
QQ046_RS03130 (QQ046_03130) 694536..694793 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 -
QQ046_RS03135 (QQ046_03135) 694976..696211 - 1236 WP_003403128.1 ATP-binding protein -
QQ046_RS03140 (QQ046_03140) 696462..696875 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin Toxin
QQ046_RS03145 (QQ046_03145) 696872..697108 - 237 WP_003403139.1 type II toxin-antitoxin system antitoxin VapB27 Antitoxin
QQ046_RS03150 (QQ046_03150) 697212..697718 - 507 WP_003900973.1 two component system sensor kinase HK1 -
QQ046_RS03155 (QQ046_03155) 697832..698362 - 531 WP_003917320.1 two component system sensor kinase HK2 -
QQ046_RS03160 (QQ046_03160) 698346..699041 - 696 WP_003918099.1 two-component system response regulator TcrA -
QQ046_RS03165 (QQ046_03165) 699164..699475 + 312 WP_003403164.1 hypothetical protein -
QQ046_RS03170 (QQ046_03170) 699547..700497 + 951 WP_003900184.1 DUF1259 domain-containing protein -
QQ046_RS03175 (QQ046_03175) 700738..701322 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
QQ046_RS03180 (QQ046_03180) 701324..702034 + 711 Protein_630 IS607 family element RNA-guided endonuclease TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-126)

Antitoxin

SpoVT-AbrB domain

(3-43)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14786.14 Da        Isoelectric Point: 8.1405

>T283754 WP_003403137.1 NZ_CP127273:c696875-696462 [Mycobacterium tuberculosis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA

Download         Length: 414 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8212.41 Da        Isoelectric Point: 5.0351

>AT283754 WP_003403139.1 NZ_CP127273:c697108-696872 [Mycobacterium tuberculosis]
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ88

Antitoxin

Source ID Structure
AlphaFold DB G0TQ89

References