283745

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 29100..29601 Replicon plasmid pQ503
Accession NZ_CP127260
Organism Escherichia coli strain Q5

Toxin (Protein)


Gene name TsxA Uniprot ID H1ZXU8
Locus tag QQ972_RS25720 Protein ID WP_000702247.1
Coordinates 29100..29360 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag QQ972_RS25725 Protein ID WP_001132407.1
Coordinates 29350..29601 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQ972_RS25675 (QQ972_25680) 24639..24791 + 153 Protein_31 DUF5431 family protein -
QQ972_RS25680 (QQ972_25685) 24736..24858 + 123 WP_223170659.1 type I toxin-antitoxin system Hok family toxin -
QQ972_RS25685 (QQ972_25690) 25008..25604 + 597 WP_000125165.1 ProQ/FINO family protein -
QQ972_RS25690 (QQ972_25695) 25622..25906 - 285 WP_001162371.1 hypothetical protein -
QQ972_RS25695 (QQ972_25700) 25980..26645 - 666 WP_000532148.1 division plane positioning ATPase MipZ -
QQ972_RS25700 (QQ972_25705) 27243..27572 + 330 WP_000855120.1 hypothetical protein -
QQ972_RS25705 (QQ972_25710) 28153..28476 + 324 WP_000427403.1 hypothetical protein -
QQ972_RS25710 (QQ972_25715) 28518..28727 + 210 WP_000866036.1 hypothetical protein -
QQ972_RS25715 (QQ972_25720) 28824..29048 + 225 WP_000814381.1 hypothetical protein -
QQ972_RS25720 (QQ972_25725) 29100..29360 + 261 WP_000702247.1 hypothetical protein Toxin
QQ972_RS25725 (QQ972_25730) 29350..29601 + 252 WP_001132407.1 transcriptional regulator Antitoxin
QQ972_RS25730 (QQ972_25735) 30151..30429 + 279 WP_000545938.1 hypothetical protein -
QQ972_RS25735 (QQ972_25740) 30849..31115 + 267 WP_000681608.1 type II toxin-antitoxin system HicB family antitoxin -
QQ972_RS25740 (QQ972_25745) 31222..31665 - 444 WP_000068545.1 hypothetical protein -
QQ972_RS25745 (QQ972_25750) 31962..32144 + 183 WP_285985053.1 type II toxin-antitoxin system HicA family toxin -
QQ972_RS25750 (QQ972_25755) 32169..32606 + 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
QQ972_RS25755 (QQ972_25760) 32737..33063 - 327 WP_000206697.1 hypothetical protein -
QQ972_RS25760 (QQ972_25765) 33083..33790 - 708 WP_021503228.1 hypothetical protein -
QQ972_RS25765 (QQ972_25770) 33792..34544 - 753 WP_000797966.1 conjugal transfer protein TraL -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..58011 58011


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9817.29 Da        Isoelectric Point: 10.0665

>T283745 WP_000702247.1 NZ_CP127260:29100-29360 [Escherichia coli]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEKAFDTIDFASDGLRENDKEIVSMMIQEMS
EGKNAK

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9404.77 Da        Isoelectric Point: 9.8120

>AT283745 WP_001132407.1 NZ_CP127260:29350-29601 [Escherichia coli]
MPNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1P8DNC0

Antitoxin

Source ID Structure

References