Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 41635..42236 Replicon plasmid pQ502
Accession NZ_CP127257
Organism Escherichia coli strain Q5

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag QQ972_RS25020 Protein ID WP_001216045.1
Coordinates 41635..42015 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QQ972_RS25025 Protein ID WP_001190712.1
Coordinates 42015..42236 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQ972_RS24990 (QQ972_24990) 36761..36991 - 231 Protein_36 ash family protein -
QQ972_RS24995 (QQ972_24995) 37075..38559 - 1485 WP_000124159.1 hypothetical protein -
QQ972_RS25000 (QQ972_25000) 38559..39752 - 1194 WP_000219604.1 terminase -
QQ972_RS25005 (QQ972_25005) 39839..40291 - 453 WP_001312282.1 late promoter-activating protein (Gp10) -
QQ972_RS25010 (QQ972_25010) 40380..41423 - 1044 WP_000648827.1 DUF968 domain-containing protein -
QQ972_RS25015 (QQ972_25015) 41451..41630 - 180 WP_000113019.1 hypothetical protein -
QQ972_RS25020 (QQ972_25020) 41635..42015 - 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QQ972_RS25025 (QQ972_25025) 42015..42236 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QQ972_RS25030 (QQ972_25030) 42309..42698 - 390 WP_000506730.1 S24 family peptidase -
QQ972_RS25035 (QQ972_25035) 42873..43457 + 585 WP_001133668.1 hypothetical protein -
QQ972_RS25040 (QQ972_25040) 43458..43814 + 357 WP_001062546.1 hypothetical protein -
QQ972_RS25045 (QQ972_25050) 44890..45252 - 363 WP_001261544.1 hypothetical protein -
QQ972_RS25050 (QQ972_25055) 45249..46181 - 933 WP_096983428.1 hypothetical protein -
QQ972_RS25055 (QQ972_25060) 46163..46537 - 375 WP_023154376.1 hypothetical protein -
QQ972_RS25060 (QQ972_25065) 46544..46837 - 294 WP_039719968.1 hypothetical protein -
QQ972_RS25065 (QQ972_25070) 46861..47142 - 282 WP_000002126.1 ASCH domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..98314 98314


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T283744 WP_001216045.1 NZ_CP127257:c42015-41635 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT283744 WP_001190712.1 NZ_CP127257:c42236-42015 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References