Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 102738..103363 | Replicon | plasmid pQ501 |
Accession | NZ_CP127256 | ||
Organism | Escherichia coli strain Q5 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A828AN07 |
Locus tag | QQ972_RS24630 | Protein ID | WP_059257082.1 |
Coordinates | 102738..103136 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A8H9EG71 |
Locus tag | QQ972_RS24635 | Protein ID | WP_000450526.1 |
Coordinates | 103136..103363 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ972_RS24615 (98986) | 98986..99489 | + | 504 | WP_285985015.1 | conjugal transfer entry exclusion protein TraS | - |
QQ972_RS24620 (99529) | 99529..100260 | + | 732 | WP_000850422.1 | conjugal transfer complement resistance protein TraT | - |
QQ972_RS24625 (100513) | 100513..102729 | + | 2217 | WP_285985016.1 | type IV conjugative transfer system coupling protein TraD | - |
QQ972_RS24630 (102738) | 102738..103136 | - | 399 | WP_059257082.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
QQ972_RS24635 (103136) | 103136..103363 | - | 228 | WP_000450526.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | iroN / iroN / iroE / iroD / iroC / iroB / papH / papC / papD / vat / vat / afaC-I | 1..137541 | 137541 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14945.27 Da Isoelectric Point: 7.8605
>T283743 WP_059257082.1 NZ_CP127256:c103136-102738 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNIREFERMDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNIREFERMDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|