Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4795728..4796382 | Replicon | chromosome |
| Accession | NZ_CP127255 | ||
| Organism | Escherichia coli strain Q5 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | QQ972_RS23220 | Protein ID | WP_000244781.1 |
| Coordinates | 4795728..4796135 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | QQ972_RS23225 | Protein ID | WP_000354046.1 |
| Coordinates | 4796116..4796382 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ972_RS23200 (4791685) | 4791685..4793418 | - | 1734 | WP_000813193.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| QQ972_RS23205 (4793424) | 4793424..4794134 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QQ972_RS23210 (4794159) | 4794159..4795055 | - | 897 | WP_097751990.1 | site-specific tyrosine recombinase XerD | - |
| QQ972_RS23215 (4795167) | 4795167..4795688 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| QQ972_RS23220 (4795728) | 4795728..4796135 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| QQ972_RS23225 (4796116) | 4796116..4796382 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| QQ972_RS23230 (4796625) | 4796625..4797605 | + | 981 | WP_000886080.1 | tRNA-modifying protein YgfZ | - |
| QQ972_RS23235 (4797682) | 4797682..4798341 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| QQ972_RS23240 (4798505) | 4798505..4798816 | - | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| QQ972_RS23245 (4798861) | 4798861..4800294 | + | 1434 | WP_285984905.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T283737 WP_000244781.1 NZ_CP127255:c4796135-4795728 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|