Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 4672466..4673049 | Replicon | chromosome |
Accession | NZ_CP127255 | ||
Organism | Escherichia coli strain Q5 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | V0SV58 |
Locus tag | QQ972_RS22705 | Protein ID | WP_000254750.1 |
Coordinates | 4672466..4672801 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | QQ972_RS22710 | Protein ID | WP_000581937.1 |
Coordinates | 4672801..4673049 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ972_RS22690 (4668352) | 4668352..4669650 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
QQ972_RS22695 (4669738) | 4669738..4671375 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
QQ972_RS22700 (4671603) | 4671603..4672394 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
QQ972_RS22705 (4672466) | 4672466..4672801 | - | 336 | WP_000254750.1 | endoribonuclease MazF | Toxin |
QQ972_RS22710 (4672801) | 4672801..4673049 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QQ972_RS22715 (4673127) | 4673127..4675361 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
QQ972_RS22720 (4675409) | 4675409..4676710 | - | 1302 | WP_000046817.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12067.95 Da Isoelectric Point: 8.2618
>T283736 WP_000254750.1 NZ_CP127255:c4672801-4672466 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|