Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2223215..2223833 | Replicon | chromosome |
Accession | NZ_CP127255 | ||
Organism | Escherichia coli strain Q5 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QQ972_RS10580 | Protein ID | WP_001291435.1 |
Coordinates | 2223215..2223433 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QQ972_RS10585 | Protein ID | WP_000344800.1 |
Coordinates | 2223459..2223833 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ972_RS10545 (2218502) | 2218502..2219074 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
QQ972_RS10550 (2219105) | 2219105..2219416 | - | 312 | WP_000409908.1 | MGMT family protein | - |
QQ972_RS10560 (2219795) | 2219795..2220148 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QQ972_RS10565 (2220190) | 2220190..2221740 | - | 1551 | WP_001298569.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QQ972_RS10570 (2221904) | 2221904..2222374 | - | 471 | WP_000136192.1 | YlaC family protein | - |
QQ972_RS10575 (2222490) | 2222490..2223041 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
QQ972_RS10580 (2223215) | 2223215..2223433 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QQ972_RS10585 (2223459) | 2223459..2223833 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QQ972_RS10590 (2224377) | 2224377..2227526 | - | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
QQ972_RS10595 (2227549) | 2227549..2228742 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T283723 WP_001291435.1 NZ_CP127255:c2223433-2223215 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT283723 WP_000344800.1 NZ_CP127255:c2223833-2223459 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |