Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 18672..19500 | Replicon | chromosome |
Accession | NZ_CP127255 | ||
Organism | Escherichia coli strain Q5 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | QQ972_RS00090 | Protein ID | WP_089569554.1 |
Coordinates | 19126..19500 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | QQ972_RS00085 | Protein ID | WP_024230663.1 |
Coordinates | 18672..19037 (+) | Length | 122 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ972_RS00065 (16427) | 16427..17245 | + | 819 | WP_285984910.1 | DUF932 domain-containing protein | - |
QQ972_RS00070 (17337) | 17337..17822 | + | 486 | WP_097751936.1 | antirestriction protein | - |
QQ972_RS00075 (17838) | 17838..18314 | + | 477 | WP_001351157.1 | RadC family protein | - |
QQ972_RS00080 (18377) | 18377..18598 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
QQ972_RS00085 (18672) | 18672..19037 | + | 366 | WP_024230663.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QQ972_RS00090 (19126) | 19126..19500 | + | 375 | WP_089569554.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
QQ972_RS00095 (19500) | 19500..19697 | + | 198 | Protein_18 | DUF5983 family protein | - |
QQ972_RS00100 (19725) | 19725..19922 | + | 198 | WP_023563519.1 | DUF957 domain-containing protein | - |
QQ972_RS00105 (20007) | 20007..20848 | + | 842 | Protein_20 | DUF4942 domain-containing protein | - |
QQ972_RS00110 (21128) | 21128..21664 | - | 537 | WP_000942816.1 | GspM family type II secretion system protein YghD | - |
QQ972_RS00115 (21666) | 21666..22844 | - | 1179 | WP_053294551.1 | type II secretion system protein GspL | - |
QQ972_RS00120 (22841) | 22841..23818 | - | 978 | WP_097751935.1 | type II secretion system minor pseudopilin GspK | - |
QQ972_RS00125 (23815) | 23815..24420 | - | 606 | WP_001250457.1 | type II secretion system minor pseudopilin GspJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13800.77 Da Isoelectric Point: 6.4612
>T283717 WP_089569554.1 NZ_CP127255:19126-19500 [Escherichia coli]
MKTLPVLPGQAASSRLSPVEIWQILLSRLLDQHYGLTLDDTPFADERVIEQHIEAGISLCDAVNFLVEKYTLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRLSPVEIWQILLSRLLDQHYGLTLDDTPFADERVIEQHIEAGISLCDAVNFLVEKYTLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|