Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 82987..83512 | Replicon | plasmid pC4101 |
| Accession | NZ_CP127254 | ||
| Organism | Escherichia coli strain C41 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | QQ971_RS25055 | Protein ID | WP_001159868.1 |
| Coordinates | 83207..83512 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | Q3ZU16 |
| Locus tag | QQ971_RS25050 | Protein ID | WP_000813639.1 |
| Coordinates | 82987..83205 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ971_RS25035 (78264) | 78264..78368 | - | 105 | WP_001443026.1 | IS3 family transposase | - |
| QQ971_RS25040 (78396) | 78396..79233 | - | 838 | Protein_70 | helix-turn-helix domain-containing protein | - |
| QQ971_RS25045 (79916) | 79916..80881 | - | 966 | Protein_71 | IS3 family transposase | - |
| QQ971_RS25050 (82987) | 82987..83205 | + | 219 | WP_000813639.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QQ971_RS25055 (83207) | 83207..83512 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QQ971_RS25060 (83513) | 83513..84319 | + | 807 | WP_069892513.1 | site-specific integrase | - |
| QQ971_RS25065 (85313) | 85313..86479 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| QQ971_RS25070 (86479) | 86479..87450 | + | 972 | WP_000817031.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..114529 | 114529 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T283713 WP_001159868.1 NZ_CP127254:83207-83512 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|