Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 29207..29850 | Replicon | plasmid pC4101 |
| Accession | NZ_CP127254 | ||
| Organism | Escherichia coli strain C41 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | QQ971_RS24830 | Protein ID | WP_001044768.1 |
| Coordinates | 29207..29623 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | QQ971_RS24835 | Protein ID | WP_001261287.1 |
| Coordinates | 29620..29850 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ971_RS24815 (25706) | 25706..26296 | - | 591 | WP_000194578.1 | hypothetical protein | - |
| QQ971_RS24820 (26296) | 26296..26553 | - | 258 | WP_000371891.1 | hypothetical protein | - |
| QQ971_RS24825 (26907) | 26907..29045 | + | 2139 | WP_000350638.1 | AAA family ATPase | - |
| QQ971_RS24830 (29207) | 29207..29623 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QQ971_RS24835 (29620) | 29620..29850 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QQ971_RS24840 (30146) | 30146..30436 | + | 291 | WP_000111771.1 | hypothetical protein | - |
| QQ971_RS24845 (30426) | 30426..31325 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
| QQ971_RS24850 (31375) | 31375..33600 | - | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
| QQ971_RS24855 (33712) | 33712..34305 | + | 594 | Protein_33 | IS21-like element IS21 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..114529 | 114529 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T283712 WP_001044768.1 NZ_CP127254:c29623-29207 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |