Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3798..4423 | Replicon | plasmid pC4101 |
Accession | NZ_CP127254 | ||
Organism | Escherichia coli strain C41 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QQ971_RS24710 | Protein ID | WP_000911324.1 |
Coordinates | 3798..4196 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | L4J1D2 |
Locus tag | QQ971_RS24715 | Protein ID | WP_000450532.1 |
Coordinates | 4196..4423 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ971_RS24695 (106) | 106..627 | + | 522 | WP_000632670.1 | conjugal transfer entry exclusion protein TraS | - |
QQ971_RS24700 (652) | 652..1383 | + | 732 | WP_000850422.1 | conjugal transfer complement resistance protein TraT | - |
QQ971_RS24705 (1636) | 1636..3789 | + | 2154 | WP_286004812.1 | type IV conjugative transfer system coupling protein TraD | - |
QQ971_RS24710 (3798) | 3798..4196 | - | 399 | WP_000911324.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QQ971_RS24715 (4196) | 4196..4423 | - | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..114529 | 114529 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14800.09 Da Isoelectric Point: 7.8604
>T283711 WP_000911324.1 NZ_CP127254:c4196-3798 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|