Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 4113543..4114168 | Replicon | chromosome |
| Accession | NZ_CP127252 | ||
| Organism | Escherichia coli strain C41 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QQ971_RS20160 | Protein ID | WP_000911330.1 |
| Coordinates | 4113543..4113941 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | QQ971_RS20165 | Protein ID | WP_000450524.1 |
| Coordinates | 4113941..4114168 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ971_RS20140 (4109421) | 4109421..4109621 | + | 201 | WP_000383836.1 | YpfN family protein | - |
| QQ971_RS20145 (4109731) | 4109731..4110429 | - | 699 | WP_000679812.1 | esterase | - |
| QQ971_RS20150 (4110503) | 4110503..4112518 | - | 2016 | WP_089638850.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| QQ971_RS20155 (4112533) | 4112533..4113396 | - | 864 | WP_001267495.1 | neutral zinc metallopeptidase | - |
| QQ971_RS20160 (4113543) | 4113543..4113941 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QQ971_RS20165 (4113941) | 4113941..4114168 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| QQ971_RS20170 (4114322) | 4114322..4115035 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| QQ971_RS20175 (4115248) | 4115248..4116282 | - | 1035 | WP_001330579.1 | outer membrane protein assembly factor BamC | - |
| QQ971_RS20180 (4116299) | 4116299..4117177 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| QQ971_RS20185 (4117323) | 4117323..4117895 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| QQ971_RS20190 (4117895) | 4117895..4118365 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T283706 WP_000911330.1 NZ_CP127252:c4113941-4113543 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|