Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3107634..3108160 | Replicon | chromosome |
| Accession | NZ_CP127252 | ||
| Organism | Escherichia coli strain C41 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | QQ971_RS15140 | Protein ID | WP_000323025.1 |
| Coordinates | 3107634..3107921 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | QQ971_RS15145 | Protein ID | WP_000534858.1 |
| Coordinates | 3107921..3108160 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ971_RS15090 (3102658) | 3102658..3102873 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| QQ971_RS15095 (3103093) | 3103093..3103263 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
| QQ971_RS15100 (3103627) | 3103627..3103842 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| QQ971_RS15105 (3104143) | 3104143..3104355 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| QQ971_RS15110 (3104410) | 3104410..3104499 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| QQ971_RS15115 (3104777) | 3104777..3105529 | - | 753 | WP_001047135.1 | antitermination protein | - |
| QQ971_RS15120 (3105543) | 3105543..3106592 | - | 1050 | WP_089638881.1 | DUF968 domain-containing protein | - |
| QQ971_RS15125 (3106594) | 3106594..3106872 | - | 279 | WP_012304870.1 | hypothetical protein | - |
| QQ971_RS15130 (3106939) | 3106939..3107190 | - | 252 | WP_000980994.1 | protein Rem | - |
| QQ971_RS15135 (3107407) | 3107407..3107562 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| QQ971_RS15140 (3107634) | 3107634..3107921 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| QQ971_RS15145 (3107921) | 3107921..3108160 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| QQ971_RS15150 (3108185) | 3108185..3108490 | + | 306 | WP_001326990.1 | protein YdfV | - |
| QQ971_RS15155 (3108693) | 3108693..3109025 | + | 333 | WP_001317460.1 | FlxA-like family protein | - |
| QQ971_RS15160 (3109462) | 3109462..3109611 | - | 150 | WP_011443592.1 | protein YdfW | - |
| QQ971_RS15165 (3109732) | 3109732..3110394 | - | 663 | Protein_2957 | IS1202-like element ISEsa1 family transposase | - |
| QQ971_RS15170 (3110432) | 3110432..3110803 | - | 372 | WP_001406656.1 | helix-turn-helix domain-containing protein | - |
| QQ971_RS15175 (3111572) | 3111572..3111859 | - | 288 | Protein_2959 | hypothetical protein | - |
| QQ971_RS15180 (3112337) | 3112337..3112826 | - | 490 | Protein_2960 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3064911..3133060 | 68149 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T283699 WP_000323025.1 NZ_CP127252:c3107921-3107634 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|