Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1787470..1788088 | Replicon | chromosome |
Accession | NZ_CP127252 | ||
Organism | Escherichia coli strain C41 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QQ971_RS08535 | Protein ID | WP_001291435.1 |
Coordinates | 1787470..1787688 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QQ971_RS08540 | Protein ID | WP_000344800.1 |
Coordinates | 1787714..1788088 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ971_RS08500 (1782759) | 1782759..1783331 | + | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
QQ971_RS08505 (1783362) | 1783362..1783673 | - | 312 | WP_000409911.1 | MGMT family protein | - |
QQ971_RS08515 (1784052) | 1784052..1784405 | + | 354 | WP_000878141.1 | DUF1428 family protein | - |
QQ971_RS08520 (1784447) | 1784447..1785997 | - | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QQ971_RS08525 (1786161) | 1786161..1786631 | - | 471 | WP_000136192.1 | YlaC family protein | - |
QQ971_RS08530 (1786747) | 1786747..1787298 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
QQ971_RS08535 (1787470) | 1787470..1787688 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QQ971_RS08540 (1787714) | 1787714..1788088 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QQ971_RS08545 (1788634) | 1788634..1791783 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QQ971_RS08550 (1791806) | 1791806..1792999 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T283692 WP_001291435.1 NZ_CP127252:c1787688-1787470 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT283692 WP_000344800.1 NZ_CP127252:c1788088-1787714 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |