Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 1753174..1754011 | Replicon | chromosome |
| Accession | NZ_CP127252 | ||
| Organism | Escherichia coli strain C41 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | QQ971_RS08365 | Protein ID | WP_000227784.1 |
| Coordinates | 1753174..1753716 (-) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | QQ971_RS08370 | Protein ID | WP_001297137.1 |
| Coordinates | 1753700..1754011 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ971_RS08345 (1748713) | 1748713..1749624 | - | 912 | WP_000705853.1 | 2-dehydropantoate 2-reductase | - |
| QQ971_RS08350 (1749792) | 1749792..1750283 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| QQ971_RS08355 (1750411) | 1750411..1751775 | - | 1365 | WP_001000960.1 | MFS transporter | - |
| QQ971_RS08360 (1752183) | 1752183..1753118 | + | 936 | WP_001368479.1 | tetratricopeptide repeat protein | - |
| QQ971_RS08365 (1753174) | 1753174..1753716 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| QQ971_RS08370 (1753700) | 1753700..1754011 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| QQ971_RS08375 (1754196) | 1754196..1755086 | - | 891 | WP_000971336.1 | heme o synthase | - |
| QQ971_RS08380 (1755098) | 1755098..1755427 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| QQ971_RS08385 (1755427) | 1755427..1756041 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| QQ971_RS08390 (1756031) | 1756031..1758022 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| QQ971_RS08395 (1758044) | 1758044..1758991 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T283691 WP_000227784.1 NZ_CP127252:c1753716-1753174 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|