Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 1029584..1030179 | Replicon | chromosome |
Accession | NZ_CP127252 | ||
Organism | Escherichia coli strain C41 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | QQ971_RS04895 | Protein ID | WP_000239579.1 |
Coordinates | 1029829..1030179 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | QQ971_RS04890 | Protein ID | WP_001223208.1 |
Coordinates | 1029584..1029835 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ971_RS04880 (1025246) | 1025246..1029027 | + | 3782 | Protein_937 | autotransporter assembly complex protein TamB | - |
QQ971_RS04885 (1029030) | 1029030..1029371 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
QQ971_RS04890 (1029584) | 1029584..1029835 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
QQ971_RS04895 (1029829) | 1029829..1030179 | + | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
QQ971_RS04900 (1030259) | 1030259..1030789 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
QQ971_RS04905 (1031099) | 1031099..1032055 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
QQ971_RS04910 (1032195) | 1032195..1033696 | + | 1502 | Protein_943 | sugar ABC transporter ATP-binding protein | - |
QQ971_RS04915 (1033710) | 1033710..1034732 | + | 1023 | WP_001296689.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T283689 WP_000239579.1 NZ_CP127252:1029829-1030179 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |