Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 2517587..2518209 | Replicon | chromosome |
Accession | NZ_CP127251 | ||
Organism | Devosia sp. YIM 151766 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | O9Z70_RS12410 | Protein ID | WP_286019761.1 |
Coordinates | 2517587..2517925 (-) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | O9Z70_RS12415 | Protein ID | WP_286019762.1 |
Coordinates | 2517928..2518209 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O9Z70_RS12385 (O9Z70_12385) | 2512956..2513144 | + | 189 | WP_286019757.1 | hypothetical protein | - |
O9Z70_RS12390 (O9Z70_12390) | 2513235..2514386 | - | 1152 | WP_286019758.1 | tRNA 2-thiouridine(34) synthase MnmA | - |
O9Z70_RS12395 (O9Z70_12395) | 2514629..2516077 | + | 1449 | WP_286019759.1 | flagellar hook-length control protein FliK | - |
O9Z70_RS12400 (O9Z70_12400) | 2516090..2516812 | + | 723 | WP_286019760.1 | flagellar hook assembly protein FlgD | - |
O9Z70_RS12405 (O9Z70_12405) | 2517211..2517489 | + | 279 | WP_035085775.1 | DUF1153 domain-containing protein | - |
O9Z70_RS12410 (O9Z70_12410) | 2517587..2517925 | - | 339 | WP_286019761.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
O9Z70_RS12415 (O9Z70_12415) | 2517928..2518209 | - | 282 | WP_286019762.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
O9Z70_RS12420 (O9Z70_12420) | 2518478..2520118 | + | 1641 | WP_286019763.1 | flagellar basal-body MS-ring/collar protein FliF | - |
O9Z70_RS12425 (O9Z70_12425) | 2520124..2521200 | + | 1077 | WP_286019764.1 | flagellar motor switch protein FliG | - |
O9Z70_RS12430 (O9Z70_12430) | 2521205..2521876 | + | 672 | WP_286019765.1 | FliH/SctL family protein | - |
O9Z70_RS12435 (O9Z70_12435) | 2521927..2522217 | + | 291 | WP_286022010.1 | flagellar motor switch protein FliN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12135.94 Da Isoelectric Point: 9.2676
>T283685 WP_286019761.1 NZ_CP127251:c2517925-2517587 [Devosia sp. YIM 151766]
MERGEIWYIDLSPAAGREPQGRHPVLVISPRAFNRSGMALVAPITTIGKASRMRGFAVNLQGAGTATTGVIQCDAIRVVD
MVQRNARQDRDRDAVPPDILDDVLARIATIAQ
MERGEIWYIDLSPAAGREPQGRHPVLVISPRAFNRSGMALVAPITTIGKASRMRGFAVNLQGAGTATTGVIQCDAIRVVD
MVQRNARQDRDRDAVPPDILDDVLARIATIAQ
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|