Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4045640..4046271 | Replicon | chromosome |
Accession | NZ_CP127244 | ||
Organism | Salinicola sp. JS01 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | QO259_RS18470 | Protein ID | WP_207036655.1 |
Coordinates | 4046089..4046271 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QO259_RS18465 | Protein ID | WP_207036657.1 |
Coordinates | 4045640..4046050 (-) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QO259_RS18445 (QO259_18445) | 4041142..4041912 | + | 771 | WP_285951110.1 | SDR family NAD(P)-dependent oxidoreductase | - |
QO259_RS18450 (QO259_18450) | 4041958..4043148 | + | 1191 | WP_285951111.1 | acetyl-CoA C-acyltransferase | - |
QO259_RS18455 (QO259_18455) | 4043204..4044949 | + | 1746 | WP_285951112.1 | AMP-binding protein | - |
QO259_RS18460 (QO259_18460) | 4044974..4045399 | - | 426 | WP_285951113.1 | hotdog fold thioesterase | - |
QO259_RS18465 (QO259_18465) | 4045640..4046050 | - | 411 | WP_207036657.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QO259_RS18470 (QO259_18470) | 4046089..4046271 | - | 183 | WP_207036655.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QO259_RS18475 (QO259_18475) | 4046998..4048395 | + | 1398 | WP_285951114.1 | GntP family permease | - |
QO259_RS18480 (QO259_18480) | 4048400..4049107 | + | 708 | WP_285951115.1 | AMP-binding protein | - |
QO259_RS18485 (QO259_18485) | 4049013..4050095 | + | 1083 | WP_285952801.1 | AMP-binding protein | - |
QO259_RS18490 (QO259_18490) | 4050127..4050594 | + | 468 | WP_285951116.1 | MaoC/PaaZ C-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6715.92 Da Isoelectric Point: 11.0703
>T283684 WP_207036655.1 NZ_CP127244:c4046271-4046089 [Salinicola sp. JS01]
VKSRDLIKELEADGWVLDRIRGSHHVFKHPTKPGAVPVPHPKKDMKIGTINAIRKQAGLK
VKSRDLIKELEADGWVLDRIRGSHHVFKHPTKPGAVPVPHPKKDMKIGTINAIRKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14864.75 Da Isoelectric Point: 4.9122
>AT283684 WP_207036657.1 NZ_CP127244:c4046050-4045640 [Salinicola sp. JS01]
MQYPIAIDWGDDTHATGIVFPDIPGAITAGDSVAHAYEMAVEVAHIQLEELVSAGQPIPKPGSIEQHRQNPDFEGWGWGL
VEIDVTPYLGKTEKVNVTLPGTLVKRIDDYVSLHGIKSRSAFLASAALHELEHRSR
MQYPIAIDWGDDTHATGIVFPDIPGAITAGDSVAHAYEMAVEVAHIQLEELVSAGQPIPKPGSIEQHRQNPDFEGWGWGL
VEIDVTPYLGKTEKVNVTLPGTLVKRIDDYVSLHGIKSRSAFLASAALHELEHRSR
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|