Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-Phd |
Location | 3423044..3423613 | Replicon | chromosome |
Accession | NZ_CP127244 | ||
Organism | Salinicola sp. JS01 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QO259_RS15600 | Protein ID | WP_285950641.1 |
Coordinates | 3423044..3423346 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QO259_RS15605 | Protein ID | WP_285950642.1 |
Coordinates | 3423359..3423613 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QO259_RS15565 (QO259_15565) | 3418170..3419363 | - | 1194 | WP_285950638.1 | serine hydrolase | - |
QO259_RS15585 (QO259_15585) | 3420089..3420952 | - | 864 | WP_106419304.1 | 23S rRNA pseudouridine(2605) synthase RluB | - |
QO259_RS15590 (QO259_15590) | 3420991..3421851 | - | 861 | WP_285950639.1 | SMC-Scp complex subunit ScpB | - |
QO259_RS15595 (QO259_15595) | 3421864..3422814 | - | 951 | WP_285950640.1 | ScpA family protein | - |
QO259_RS15600 (QO259_15600) | 3423044..3423346 | - | 303 | WP_285950641.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QO259_RS15605 (QO259_15605) | 3423359..3423613 | - | 255 | WP_285950642.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QO259_RS15610 (QO259_15610) | 3423727..3424839 | - | 1113 | WP_285950643.1 | pyrroloquinoline quinone biosynthesis protein PqqE | - |
QO259_RS15615 (QO259_15615) | 3424836..3425129 | - | 294 | WP_285950644.1 | pyrroloquinoline quinone biosynthesis peptide chaperone PqqD | - |
QO259_RS15620 (QO259_15620) | 3425126..3425926 | - | 801 | WP_285950645.1 | pyrroloquinoline-quinone synthase PqqC | - |
QO259_RS15625 (QO259_15625) | 3425914..3426807 | - | 894 | WP_233076625.1 | pyrroloquinoline quinone biosynthesis protein PqqB | - |
QO259_RS15630 (QO259_15630) | 3426852..3426980 | - | 129 | WP_285950646.1 | pyrroloquinoline quinone precursor peptide PqqA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11424.22 Da Isoelectric Point: 5.1989
>T283683 WP_285950641.1 NZ_CP127244:c3423346-3423044 [Salinicola sp. JS01]
VAELLWSQPSLQALDEIAEYIALDNPAAARALVARVLRAVERLVEFPASGRQPPELPGSGYREVVVPPCRVFYRQEGERI
LIVHLMREERALRRYMLDPE
VAELLWSQPSLQALDEIAEYIALDNPAAARALVARVLRAVERLVEFPASGRQPPELPGSGYREVVVPPCRVFYRQEGERI
LIVHLMREERALRRYMLDPE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|