Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 237790..238374 Replicon chromosome
Accession NZ_CP127244
Organism Salinicola sp. JS01

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag QO259_RS01235 Protein ID WP_285951499.1
Coordinates 238186..238374 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag QO259_RS01230 Protein ID WP_207034487.1
Coordinates 237790..238182 (-) Length 131 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QO259_RS01205 (QO259_01205) 232841..233587 + 747 WP_285951494.1 LexA family transcriptional regulator -
QO259_RS01210 (QO259_01210) 233630..234895 + 1266 WP_285951495.1 hypothetical protein -
QO259_RS01215 (QO259_01215) 235204..235440 - 237 WP_285951496.1 hypothetical protein -
QO259_RS01220 (QO259_01220) 235573..236373 - 801 WP_285951497.1 hypothetical protein -
QO259_RS01225 (QO259_01225) 237429..237779 + 351 WP_285951498.1 hypothetical protein -
QO259_RS01230 (QO259_01230) 237790..238182 - 393 WP_207034487.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QO259_RS01235 (QO259_01235) 238186..238374 - 189 WP_285951499.1 type II toxin-antitoxin system HicA family toxin Toxin
QO259_RS01240 (QO259_01240) 238563..239564 - 1002 WP_285951500.1 endonuclease -
QO259_RS01245 (QO259_01245) 239726..240445 + 720 WP_285951501.1 hypothetical protein -
QO259_RS01250 (QO259_01250) 240565..240984 - 420 WP_035470482.1 type II toxin-antitoxin system HicB family antitoxin -
QO259_RS01255 (QO259_01255) 241005..241187 - 183 WP_081919087.1 type II toxin-antitoxin system HicA family toxin -
QO259_RS01260 (QO259_01260) 241272..242273 - 1002 WP_285951502.1 contractile injection system protein, VgrG/Pvc8 family -
QO259_RS01265 (QO259_01265) 242270..242713 - 444 WP_035470479.1 phage tail protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - gnd 215776..267721 51945


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-122)


Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7189.35 Da        Isoelectric Point: 10.9252

>T283681 WP_285951499.1 NZ_CP127244:c238374-238186 [Salinicola sp. JS01]
MKSADVIKRLEAEGWHHVGGKGDHMKFKHPDKPVHVVVPHPRKDLATGTLRNIYRQAGWIWR

Download         Length: 189 bp

Antitoxin


Download         Length: 131 a.a.        Molecular weight: 14577.41 Da        Isoelectric Point: 4.6219

>AT283681 WP_207034487.1 NZ_CP127244:c238182-237790 [Salinicola sp. JS01]
MLYPAYIHKDRDSAYGVTFPDFPGCFSAADELSELPRLAQEAVEVYFDGEDMAIPPPSTPETWADHADFQDGYWMLIDID
LSKLSHRAVRVNISLPESLVAKIDHAAKARHLSRSAFLAMAAQHEMSEPR

Download         Length: 393 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References