Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 158980..159725 Replicon plasmid p1_130128
Accession NZ_CP127237
Organism Klebsiella pneumoniae strain 130128

Toxin (Protein)


Gene name tacT Uniprot ID A0A331KSM6
Locus tag QRA17_RS28850 Protein ID WP_032408901.1
Coordinates 159234..159725 (+) Length 164 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID -
Locus tag QRA17_RS28845 Protein ID WP_014386183.1
Coordinates 158980..159246 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRA17_RS28795 (QRA17_28795) 154532..154945 - 414 WP_013023817.1 helix-turn-helix domain-containing protein -
QRA17_RS28800 (QRA17_28800) 154946..155224 - 279 WP_004152721.1 helix-turn-helix transcriptional regulator -
QRA17_RS28805 (QRA17_28805) 155214..155534 - 321 WP_014386190.1 type II toxin-antitoxin system RelE/ParE family toxin -
QRA17_RS28810 (QRA17_28810) 155615..155839 - 225 WP_014386189.1 hypothetical protein -
QRA17_RS28815 (QRA17_28815) 155850..156062 - 213 WP_014386188.1 hypothetical protein -
QRA17_RS28820 (QRA17_28820) 156124..156450 - 327 WP_014386187.1 hypothetical protein -
QRA17_RS28825 (QRA17_28825) 157087..157437 - 351 WP_014386186.1 hypothetical protein -
QRA17_RS28830 (QRA17_28830) 157434..157706 - 273 WP_032408902.1 hypothetical protein -
QRA17_RS28835 (QRA17_28835) 157896..158381 + 486 WP_014386185.1 hypothetical protein -
QRA17_RS28840 (QRA17_28840) 158625..158783 - 159 WP_014386184.1 type I toxin-antitoxin system Hok family toxin -
QRA17_RS28845 (QRA17_28845) 158980..159246 + 267 WP_014386183.1 DUF1778 domain-containing protein Antitoxin
QRA17_RS28850 (QRA17_28850) 159234..159725 + 492 WP_032408901.1 GNAT family N-acetyltransferase Toxin
QRA17_RS28855 (QRA17_28855) 160166..160417 - 252 WP_032408900.1 aldo/keto reductase -
QRA17_RS28860 (QRA17_28860) 160614..162206 - 1593 Protein_179 IS66 family transposase -
QRA17_RS28865 (QRA17_28865) 162237..162587 - 351 WP_014386180.1 IS66 family insertion sequence element accessory protein TnpB -
QRA17_RS28870 (QRA17_28870) 162584..163024 - 441 WP_014386179.1 transposase -
QRA17_RS28875 (QRA17_28875) 163286..164041 - 756 WP_032408898.1 DeoR/GlpR family DNA-binding transcription regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(3')-Ia / dfrA12 / aadA2 / qacE / sul1 / mph(A) - 1..205645 205645


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(89-149)

Antitoxin

Vibrio phage ICP1, Orf50

(2-87)


Sequences

Toxin        


Download         Length: 164 a.a.        Molecular weight: 17667.46 Da        Isoelectric Point: 8.8757

>T283678 WP_032408901.1 NZ_CP127237:159234-159725 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT

Download         Length: 492 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10090.66 Da        Isoelectric Point: 5.1169

>AT283678 WP_014386183.1 NZ_CP127237:158980-159246 [Klebsiella pneumoniae]
MKSDVQLNIRAKEAQRALIDTAAEILHKSRTDFILEMACQAAENVILDRRMFNLNDEQYAEFIDMLDAPVTANPAMEKLL
ARKPQWAK

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331KSM6

Antitoxin

Source ID Structure

References