Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 148219..148862 | Replicon | plasmid pKPC2_130128 |
Accession | NZ_CP127236 | ||
Organism | Klebsiella pneumoniae strain 130128 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | QRA17_RS27910 | Protein ID | WP_001044770.1 |
Coordinates | 148219..148635 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | QRA17_RS27915 | Protein ID | WP_001261282.1 |
Coordinates | 148632..148862 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRA17_RS27890 (144322) | 144322..144594 | - | 273 | Protein_189 | transposase | - |
QRA17_RS27900 (145576) | 145576..146598 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
QRA17_RS27905 (146583) | 146583..148145 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
QRA17_RS27910 (148219) | 148219..148635 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRA17_RS27915 (148632) | 148632..148862 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QRA17_RS27920 (148819) | 148819..149280 | + | 462 | WP_014343465.1 | hypothetical protein | - |
QRA17_RS27925 (149441) | 149441..150385 | + | 945 | WP_011977810.1 | hypothetical protein | - |
QRA17_RS27930 (150422) | 150422..150814 | + | 393 | WP_011977811.1 | hypothetical protein | - |
QRA17_RS27935 (150872) | 150872..151393 | + | 522 | WP_013214008.1 | hypothetical protein | - |
QRA17_RS27940 (151439) | 151439..151642 | + | 204 | WP_011977813.1 | hypothetical protein | - |
QRA17_RS27945 (151672) | 151672..152676 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
QRA17_RS27950 (152860) | 152860..153639 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..154719 | 154719 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T283676 WP_001044770.1 NZ_CP127236:c148635-148219 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |