Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4183811..4184430 Replicon chromosome
Accession NZ_CP127235
Organism Klebsiella pneumoniae strain 130128

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QRA17_RS20845 Protein ID WP_002892050.1
Coordinates 4184212..4184430 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QRA17_RS20840 Protein ID WP_002892066.1
Coordinates 4183811..4184185 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRA17_RS20830 (QRA17_20830) 4178963..4180156 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QRA17_RS20835 (QRA17_20835) 4180179..4183325 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
QRA17_RS20840 (QRA17_20840) 4183811..4184185 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QRA17_RS20845 (QRA17_20845) 4184212..4184430 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QRA17_RS20850 (QRA17_20850) 4184589..4185155 + 567 WP_002892030.1 maltose O-acetyltransferase -
QRA17_RS20855 (QRA17_20855) 4185127..4185267 - 141 WP_004147370.1 hypothetical protein -
QRA17_RS20860 (QRA17_20860) 4185288..4185758 + 471 WP_002892026.1 YlaC family protein -
QRA17_RS20865 (QRA17_20865) 4185733..4187184 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QRA17_RS20870 (QRA17_20870) 4187285..4187983 + 699 WP_002892021.1 GNAT family protein -
QRA17_RS20875 (QRA17_20875) 4187980..4188120 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QRA17_RS20880 (QRA17_20880) 4188120..4188383 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T283664 WP_002892050.1 NZ_CP127235:4184212-4184430 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT283664 WP_002892066.1 NZ_CP127235:4183811-4184185 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References