Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 856094..856748 | Replicon | chromosome |
Accession | NZ_CP127235 | ||
Organism | Klebsiella pneumoniae strain 130128 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | R4YHX2 |
Locus tag | QRA17_RS04320 | Protein ID | WP_004144731.1 |
Coordinates | 856341..856748 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | QRA17_RS04315 | Protein ID | WP_002916312.1 |
Coordinates | 856094..856360 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRA17_RS04290 (QRA17_04290) | 851250..852683 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
QRA17_RS04295 (QRA17_04295) | 852802..853530 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
QRA17_RS04300 (QRA17_04300) | 853580..853891 | + | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
QRA17_RS04305 (QRA17_04305) | 854055..854714 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
QRA17_RS04310 (QRA17_04310) | 854865..855848 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
QRA17_RS04315 (QRA17_04315) | 856094..856360 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
QRA17_RS04320 (QRA17_04320) | 856341..856748 | + | 408 | WP_004144731.1 | protein YgfX | Toxin |
QRA17_RS04325 (QRA17_04325) | 856755..857276 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
QRA17_RS04330 (QRA17_04330) | 857377..858273 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
QRA17_RS04335 (QRA17_04335) | 858296..859009 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QRA17_RS04340 (QRA17_04340) | 859015..860748 | + | 1734 | WP_004151783.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15936.69 Da Isoelectric Point: 11.4778
>T283658 WP_004144731.1 NZ_CP127235:856341-856748 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A378E4P6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |