Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 3493..4073 | Replicon | plasmid p2_130119 |
Accession | NZ_CP127233 | ||
Organism | Klebsiella pneumoniae strain 130119 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | QRA14_RS29330 | Protein ID | WP_071177730.1 |
Coordinates | 3493..3807 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | QRA14_RS29335 | Protein ID | WP_000093040.1 |
Coordinates | 3795..4073 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRA14_RS29310 (QRA14_29315) | 1401..2132 | + | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
QRA14_RS29315 (QRA14_29320) | 2139..2669 | + | 531 | WP_071177729.1 | hypothetical protein | - |
QRA14_RS29320 (QRA14_29325) | 2696..2875 | - | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
QRA14_RS29325 (QRA14_29330) | 2901..3329 | - | 429 | WP_001140599.1 | hypothetical protein | - |
QRA14_RS29330 (QRA14_29335) | 3493..3807 | - | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QRA14_RS29335 (QRA14_29340) | 3795..4073 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
QRA14_RS29340 (QRA14_29345) | 4248..4613 | - | 366 | WP_072354022.1 | TonB family protein | - |
QRA14_RS29345 (QRA14_29350) | 4610..4981 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
QRA14_RS29350 (QRA14_29355) | 5255..5500 | - | 246 | WP_032440458.1 | hypothetical protein | - |
QRA14_RS29355 (QRA14_29360) | 5827..7512 | + | 1686 | WP_032440457.1 | colicin-like bacteriocin tRNase domain-containing protein | - |
QRA14_RS29360 (QRA14_29365) | 7522..7779 | + | 258 | WP_032440455.1 | colicin E3-like toxin immunity protein | - |
QRA14_RS29365 (QRA14_29370) | 7864..8013 | + | 150 | WP_032440454.1 | colicin release lysis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..10060 | 10060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T283653 WP_071177730.1 NZ_CP127233:c3807-3493 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|