Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 57061..57704 Replicon plasmid pOXA10_130119
Accession NZ_CP127231
Organism Klebsiella pneumoniae strain 130119

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag QRA14_RS28020 Protein ID WP_001044770.1
Coordinates 57288..57704 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag QRA14_RS28015 Protein ID WP_001261282.1
Coordinates 57061..57291 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRA14_RS27985 (QRA14_27990) 52070..53245 + 1176 Protein_50 IS3 family transposase -
QRA14_RS27990 (QRA14_27995) 53627..54412 - 786 WP_050485696.1 site-specific integrase -
QRA14_RS27995 (QRA14_28000) 54458..54979 - 522 WP_032448294.1 hypothetical protein -
QRA14_RS28000 (QRA14_28005) 55037..55429 - 393 WP_074422814.1 hypothetical protein -
QRA14_RS28005 (QRA14_28010) 55538..56482 - 945 WP_032448293.1 hypothetical protein -
QRA14_RS28010 (QRA14_28015) 56682..57104 - 423 WP_050485703.1 hypothetical protein -
QRA14_RS28015 (QRA14_28020) 57061..57291 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QRA14_RS28020 (QRA14_28025) 57288..57704 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
QRA14_RS28025 (QRA14_28030) 57778..59340 + 1563 WP_004206609.1 AAA family ATPase -
QRA14_RS28030 (QRA14_28035) 59325..60347 + 1023 WP_000361404.1 helicase UvrD -
QRA14_RS28035 (QRA14_28040) 60892..61800 + 909 WP_137877090.1 HNH endonuclease -
QRA14_RS28040 (QRA14_28045) 61986..62336 - 351 WP_004187110.1 DUF305 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / dfrA14 / ant(3'')-Ia / blaOXA-10 / cmlA1 / ARR-3 / blaLAP-2 / qnrS1 iutA / iucD / iucC / iucB / iucA 1..258228 258228


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T283651 WP_001044770.1 NZ_CP127231:57288-57704 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT283651 WP_001261282.1 NZ_CP127231:57061-57291 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References