Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 57061..57704 | Replicon | plasmid pOXA10_130119 |
Accession | NZ_CP127231 | ||
Organism | Klebsiella pneumoniae strain 130119 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | QRA14_RS28020 | Protein ID | WP_001044770.1 |
Coordinates | 57288..57704 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | QRA14_RS28015 | Protein ID | WP_001261282.1 |
Coordinates | 57061..57291 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRA14_RS27985 (QRA14_27990) | 52070..53245 | + | 1176 | Protein_50 | IS3 family transposase | - |
QRA14_RS27990 (QRA14_27995) | 53627..54412 | - | 786 | WP_050485696.1 | site-specific integrase | - |
QRA14_RS27995 (QRA14_28000) | 54458..54979 | - | 522 | WP_032448294.1 | hypothetical protein | - |
QRA14_RS28000 (QRA14_28005) | 55037..55429 | - | 393 | WP_074422814.1 | hypothetical protein | - |
QRA14_RS28005 (QRA14_28010) | 55538..56482 | - | 945 | WP_032448293.1 | hypothetical protein | - |
QRA14_RS28010 (QRA14_28015) | 56682..57104 | - | 423 | WP_050485703.1 | hypothetical protein | - |
QRA14_RS28015 (QRA14_28020) | 57061..57291 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QRA14_RS28020 (QRA14_28025) | 57288..57704 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRA14_RS28025 (QRA14_28030) | 57778..59340 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
QRA14_RS28030 (QRA14_28035) | 59325..60347 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
QRA14_RS28035 (QRA14_28040) | 60892..61800 | + | 909 | WP_137877090.1 | HNH endonuclease | - |
QRA14_RS28040 (QRA14_28045) | 61986..62336 | - | 351 | WP_004187110.1 | DUF305 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / dfrA14 / ant(3'')-Ia / blaOXA-10 / cmlA1 / ARR-3 / blaLAP-2 / qnrS1 | iutA / iucD / iucC / iucB / iucA | 1..258228 | 258228 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T283651 WP_001044770.1 NZ_CP127231:57288-57704 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |